SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000002869 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSAPLP00000002869
Domain Number - Region: 1-62
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000958
Family Ubiquitin-related 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000002869   Gene: ENSAPLG00000003339   Transcript: ENSAPLT00000003463
Sequence length 1598
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB742667.1:120944:181513:1 gene:ENSAPLG00000003339 transcript:ENSAPLT00000003463 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKLYVFLVNTGTTLTFDTELAVQNVADLKHAIQTKYKIAIQHQVLVVNGGECMAPDRRVC
SYSAGTDTNPIFLFNKEMILCERPPAIPKTTFSAENEMELKVEESLMMPAVFHTVASRTQ
LAVEMYEVAKKLCSFCEGLVHDEHLQHQGWAAIMANLEDCTYSYQKLLFKFENVYSSYLQ
SIDDIKLKLTHLGSAVSIMAKIPLLECLTRHSYRECLGRLDSSAEHGGAESEETEDGKSP
ELVLYSDVSKVNNKSMLASFCKSVEHSALEGTNPENVKDDKESGQNATVQDNETSVELKD
DDQPSFNVSLLDWINVQDRPNDVESLVRKCFDSMSRLDPRIIQPFLAECRQTIAKLDNQN
MKAIKGLEDRLYALDQMIASCSRLVNEQKELAQGFLANQKRAENLKDPSVLPDLCLSHAN
QLMIMLTNHRKLLDIKQKCTTAKQELANNLQVRLKWCCFVMLHADQDGEKLQALLRLVTE
LLERVKVVEALSTVPQMYCLAVVEVVRRKMFIKHYREWAGALIKDGKHLYEAERAKRESF
GKLFRKSFLRNRLFRGLDSWPPSFCTRKPRRFDSELPDISLSDLQFLQSFCPSEVQPLLR
VPILCDFEPLHQHVRALHNLVKAAQSLDEMSQTITDLLNEQKASNSQASPQSATTPRMES
TTGTTIATSSKTPPSLSLQGPLCPPVCPPAPLEELSPDSIDAHTFDFETIAHPNLEQALK
QGSLDLDSLAESPESDFMSAVNEFVIEENPVSPNVISDPQSPEMMVESLYSSVINAIDSR
RMQDTNSCVKDVSVENASLSVCMEKCRVIAQDSKVHLRGIKEDLCHFRTLVQREQCDFSN
SLKCTSLEILNTIEKVKLSLEKTLKDKHQKELQSLKSEYETKINKLLEDSEESQKKITKL
KGDLLGLEEVLQNKNDEFAMVKNEKEAVVCLQNEKDQKLHELECKMETQNCEIKKLRQSR
ETVLEDLKKFHVESDERLQLLRAELQSLEQSHLKELENNLQARHLQEFEKVLAEHKDCLD
KLKKENQQRLEQMQESHAAVVQEKQQQVEELKLKVSDLSDIRCKLEVELALKEAETDEMK
LLLEESRNQQQETLKSQIDKETESLKKEIDKLNSKIQNSSDEYQVGLSELRTLMTIEKDQ
CISELVDRYEEESNLLRTELNKVTVLHQKTCEAEKRLSEQITELQSKLELEVNALEKEKT
EKMALCEQREKYEAIIHTLKEEKELLVSNQEQDRQLLIQKLNSEKEDAVQTACKEFELQR
EAAEKGLLEKIQQLEMQVNRSPPTESSAESTLVAELQEKLQEEKMKFLEQLEEQERRKNE
EMQNIRTSLTAEQQTNFNTVLAREKMKKENIINDLSDKLKVLTQQQEKDKDLIETLSEDR
ARLLEEKKKLEEQVNKLRSSNLTPSTYLAAASEACGACAADIPADTDRLASDIAAEGRMD
STMETSMMAVHENVHMSEEKQRIMLLERTLQLKEEENKRLNQRLMSQSMSSVSSRHSEKI
AIRDFQVGDLVLIILDERHDNYVLFTVSPTLYFLHSESLAALDLKPGECASGASRRPWVL
GKVMEKEYCQAKKAQNRFKVPLGTKFYRVKAVPWNKKV
Download sequence
Identical sequences U3I6J8
XP_005013593.1.99704 ENSAPLP00000002869

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]