SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000002983 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000002983
Domain Number 1 Region: 554-772
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.12e-45
Family BCR-homology GTPase activation domain (BH-domain) 0.00012
Further Details:      
 
Domain Number 2 Region: 420-540
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.000000000305
Family PLC-like (P variant) 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000002983   Gene: ENSAPLG00000003510   Transcript: ENSAPLT00000003577
Sequence length 939
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB743342.1:1035262:1055751:-1 gene:ENSAPLG00000003510 transcript:ENSAPLT00000003577 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DLIENVYIAPRSRKEPKSPKASEVPEHRPQMNSITVSKKRNWLHQSTHRAPCVPKSPSPQ
PTPKTQKAPAKSPGGQEHPVPGCGAVSALPSTAGSTVLRRCPFDFGEDNDADDEGEIWYN
PIPEDDEPDVVRVLRPAANHPVTTDCPAGCCKSVPSRDLGRELGPHAGPPGSPEHAGDAQ
PGELGPADAVHPGEQLQQQRQRFASKTQGVPAAEDNPPVLEMWQKGSGVILAHKADIPST
EISPPSPSPLKKSGSINWPFPDRIKSPRTVRKLSMKMKKLPELSRKLSVKGTSSHNSSDN
PSSLLKGNCRDTSHTTSSPSSGNSTAAASRNVISRYHLDSSVSSQHTYKKKSSRSSKSSS
KGGYLSDGDSPELITKSGKHGPETKCGKGKESLPSNSGKTEIDIDAFRHYNFSDQPKCSQ
YISGLMSIHFYGAEDLKPPRIDSKDVFCAIQVDSVNKARTALLTCRTTFLDMDHTFNIEI
ENAQHLKLVVFSWEPTPRKNRVCCHGTVALPTLFRVTKTHQLAVRLEPRGLIYVKLSLME
QWENSLDGLDADREPVMFGVDARKVVEKENTGLMVPLLIQKCIMEIEKRGCQVVGLYRLC
GSAAVKKELREAFERDSKAVTLSESQYPDINVITGVLKDYLRELPSPLITKQLYEAVVDG
MVKNPLKMTANGCENDPSDSEHTVALLDCLPDVEKATLRMLLDHLKLVASYHEVNKMTCQ
NLAVCFGPVLLSQKQETTNHNNRVFTDSEELASALDFKKHIEVLHYLLQLWPVHHSAAQE
PAHPNMLPEHPSSLNYLRLRRPRPQMLNLGGTDMAGVLRLRPAGLDSPSSNRYAGDWSGC
GGSYFSDPKDCLGEADYDYVPSEDAESGDDSGRVDDLDGLTTRSQPVPGEDAFQSYLTMQ
AIDSAVDQRANLKDLQESIDTLIGNLERELNKNKLNMSF
Download sequence
Identical sequences U3I6W2
ENSAPLP00000002983

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]