SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000002999 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000002999
Domain Number 1 Region: 1244-1405
Classification Level Classification E-value
Superfamily PH domain-like 8.31e-76
Family Pleckstrin-homology domain (PH domain) 0.0000000626
Further Details:      
 
Domain Number 2 Region: 1040-1247
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 7.07e-52
Family DBL homology domain (DH-domain) 0.00000000765
Further Details:      
 
Domain Number 3 Region: 462-584
Classification Level Classification E-value
Superfamily PH domain-like 4.98e-19
Family Pleckstrin-homology domain (PH domain) 0.018
Further Details:      
 
Domain Number 4 Region: 848-928
Classification Level Classification E-value
Superfamily PDZ domain-like 0.00000000103
Family PDZ domain 0.02
Further Details:      
 
Weak hits

Sequence:  ENSAPLP00000002999
Domain Number - Region: 773-810
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0682
Family Ras-binding domain, RBD 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000002999   Gene: ENSAPLG00000003481   Transcript: ENSAPLT00000003593
Sequence length 1523
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB742951.1:237001:315353:1 gene:ENSAPLG00000003481 transcript:ENSAPLT00000003593 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGNAESQSVEHAFYGDKHASLGRKHTSRSLRLSNKASRRTRHASSGKIIHRNSEVSTRSS
STPSIPQSLAENGLEPFAQEAALEDFGSPIWVDRVDMGLRPVSYHTDSSVTPSVDSSTVL
TAASVHSMPGSEESRDEPPFLAEGDGRPHRYAPNGTGFMETASFKKKRSKSADIWREDSL
EFSLSDLSQEHLTSNEEILGLAEEKDAEAARGTEAGGGPQRGPPRLVACQRANSMSELYS
PKTPSAAVNGGPRNAFGGYCRNLVSDIPGVGGHKAASGTAEDAPSYSNYNTLPCRKSHCL
SEGATNPQLSHSNSMQGRRAKTTQDVNAGEGSEFTDSGIEGAATDTDLLSRRSNATNSSY
SPTASRAFIGSDSGSSSTGDGLRQGVYENFRRELEMSTTNSENLEEAGSALSDEQSSGTL
SSPGQSDILLTAAQGTVRKAGALAVKNFLVHKKNKKVESATRRKWKHYWVSLKGCTLFFY
ETDGRSGIDHNSIPKHAVWVENSIVQAVPEHPKKDFVFCLSNSLGDAFLFQTSSQTELEN
WITAIHSACATAVARQHHKEDTVKLLKTEIKKLEQKIDMDEKMKKMGEMQLSSVTDSKKK
KTILDQIFVWEQNLEQFQMDLFRYRCYLASLQGGELPNPKRLLAFASRPTKVAMGRLGIF
SVSSFHALVAARTGESGVRRRTQAMSRSASKRRSRFSSLWGLDTTSKKKQGRPSINQVFG
EGVDSVKKSLEGIFDDTVPDGKREKEVALSSVHQHNPDCDIWVHEYFTPSWFCLPNNQPA
LTVIRPGDTTRDVLEMICKTHQLDHSAHYLRLKFLIENQIQFYVPKPEEDIYELLYKEIE
ICQKITQHIQIEKSDASSDIYGFSLSSVEEEGIRRLYVNGVKETGLAFKKGLKAGDEIVE
INKKAAEDLDSALLKDVLVQPSLCLTVRTYPEIEEGQKLMQPPPRRLENPSDLSDSTLVF
AGSNQAGHSLCGDPDSSVETAPEEAEAQDLESSDEADKMSKSTEQVAAFCRSLHEMNPSD
SSAHPQEFTGPQLATMRQLTDADKLRKVICELLETERTYVKDLNCLMERYLKPLQKETFL
TPDELDVLFGNLTEMVAFQVEFLKTLEDGVRLVPDLEKLEKVEQFKKVLFSLGGSFLYYA
DRFKLYSAFCASHTKVPKVLVKAKTDTAFKAFLDAQNPRRQHSSTLESYLIKPIQRILKY
PLLLKELFALTDVDSEEHYHLDVAIKTMNKVASHINEMQKIHEEYGAVFDQLIAEQTGEK
KEVADLSMGDLLLHNTVIWLNPPASLGKWKKEPELAAFVFKTAVVLVYKDGSKQKKKLGG
SHRASIYEDWDPFRFRHMIPLEALQVRALASADAETNSVCEIVHVKSESEGRPERTFHLC
CSSPEHRKDFLKAVHSILRDKHRRQLLKTESLPSSQQYVPFGGKRLCALKGARPAMNRAV
SAPSKSLGRRRRRLARNRFTIDSDAVFASSPEKEPQQPTHSGDTDRWVEEQFDLAQYEEQ
EDIKETDILSDDDEYCEAVRGAA
Download sequence
Identical sequences U3I6X8
ENSAPLP00000002999

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]