SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000003036 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000003036
Domain Number 1 Region: 346-475
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 2.42e-49
Family ets domain 0.000000252
Further Details:      
 
Domain Number 2 Region: 74-178
Classification Level Classification E-value
Superfamily SAM/Pointed domain 5.71e-35
Family Pointed domain 0.00000191
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000003036   Gene: ENSAPLG00000003526   Transcript: ENSAPLT00000003631
Sequence length 483
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB743106.1:825697:898609:-1 gene:ENSAPLG00000003526 transcript:ENSAPLT00000003631 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMSYYMDTAIGSAGPYPLARPGVMQGAVGSCEDPWMTCGFQSACYQPRACYPLWDESAIQ
EVPTGLEHYSTDMECADVPLLTPSSKEMMSQALKATFSGFAKEQQRLGIPKDPQQWTETH
VRDWVMWAVNEFSLKGVDFQKFCMNGAALCALGKECFLELAPDFVGDILWEHLEILQKEE
IKPYPANGVNAAYPESRYTSDYFISYGIEHAQCVPPSEFSEPSFITESYQTLHPISSEEL
LSLKYENDYSVILRDPVQTDSLQTDYFTIKQEVVTPDNMCMGRASRGKLGGQDSFESIES
YDSCDRLTQSWSSQSSFQSLQRVPSYDSFDSEDYPAALPNHKPKGTFKDYVRDRADMNKD
KPVIPAAALAGYTGSGPIQLWQFLLELLTDKSCQSFISWTGDGWEFKLSDPDEVARRWGK
RKNKPKMNYEKLSRGLRYYYDKNIIHKTAGKRYVYRFVCDLQSLLGYTPEELHALDVKPD
ADE
Download sequence
Identical sequences U3I715
ENSAPLP00000003036

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]