SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000003062 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000003062
Domain Number 1 Region: 20-121
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 1.99e-32
Family MBT repeat 0.00051
Further Details:      
 
Domain Number 2 Region: 357-458
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 1.81e-31
Family MBT repeat 0.00045
Further Details:      
 
Domain Number 3 Region: 275-398
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 7.9e-29
Family MBT repeat 0.00088
Further Details:      
 
Domain Number 4 Region: 157-268
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 6.02e-27
Family MBT repeat 0.00011
Further Details:      
 
Domain Number 5 Region: 793-864
Classification Level Classification E-value
Superfamily SAM/Pointed domain 2.84e-17
Family SAM (sterile alpha motif) domain 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000003062   Gene: ENSAPLG00000003543   Transcript: ENSAPLT00000003657
Sequence length 869
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB743740.1:784630:816676:1 gene:ENSAPLG00000003543 transcript:ENSAPLT00000003657 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNGEQQYDADAGSGVEEMEFNWDEYLEDTGAIAAPHGSFKHVDTSLQNGFAPGMKLEVAV
KSDQNTYWVATIITTCGQLLLLRYDGYGEDRKADFWCDIMTADLHPIGWCEQNKKILKVP
EVLNPKVHKIFIFVCQELIHVCSKPVLVVLFLQLHRGKNPLDLIAPGSRLELQNFRDSLE
AWIVNVVENVGGRLKVRYEGLEDSDKFDQWIFYLDPFLHQVGWATQNGYNLQPPLAIRSL
KSEADWQEILKKVKEEEEESSVPTDLFKDKPVIGVHSFSEGMKLEAVDPMAPFVISPATV
LKVYNEKYFKIEIDDLRPERTTSRSYICHVNSAGIFPVQWSLKNGLHLSPPPGYPGQDFD
WADYLKQCGAEAAPQSCFPSLTSDHGFKENMKLEAVNPVDPEEVCIATVTKLKDSYLWLQ
LEGSKKPVPDCIVSVESMDIFPVGWCETNGYQLRPPRKAIVNKQKKIAVVQPEKQVLSSR
TVHDGLKNQELNSSDSVIINGKYCCPKIYFNHRCFSGPYLNKGRIAELPQSVGPGNCVLV
LKEVLTLLINAAYKPSRVLRELQLDEEAAWHGHGETLKAKYKGKSYRATVEVVRTADRVA
DFCRKTCIKLECCPNLFGPQMVLDKCSENCSVLTKTKYTHYYGKRKNKRIGRPPGGHSNL
EVAMKKPNKRRKRRKHFFVHKKKRSSTSVDNTPAGSPQGSGGEEEDDQDEVDEESLTEDS
TSEQQDELLEESEVSEKKSLSSSPSQSELSHSLAQDRDKRKRKLRTFSFSDDENKPPSPK
EIKIEVAEKLQLDSNPLEWSVADVVRFLKSTDCAPLARIFLDQEIDGQALLLLTLPTVQE
CMDLKLGPAIKLCHHIERVKLAFYQQFAN
Download sequence
Identical sequences U3I741
ENSAPLP00000003062

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]