SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000003079 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSAPLP00000003079
Domain Number - Region: 9-36
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0066
Family Ubiquitin-related 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000003079   Gene: ENSAPLG00000003599   Transcript: ENSAPLT00000003674
Sequence length 177
Comment pep:novel scaffold:BGI_duck_1.0:KB742640.1:2803:22867:-1 gene:ENSAPLG00000003599 transcript:ENSAPLT00000003674 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KRKIWKLLNLEDGHTLFDYNVGLNDIVQLLIRSESEAPTTVSMTDEDGEVNPCAVSNCKN
KVKKTSSGSPSQPSTSSRSFLIDPGIGLYKINELVDARDVSIGAWFEAHIENVTRATKGH
KNGKAQGKSGNTHKRTNGSLSQDHSRENANNLDSTPSTSYSDCMDTDEEAIYHIKYD
Download sequence
Identical sequences U3I758
ENSAPLP00000003079

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]