SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000003233 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000003233
Domain Number 1 Region: 1-98
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.36e-27
Family Ubiquitin-related 0.00000323
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000003233   Gene: ENSAPLG00000003732   Transcript: ENSAPLT00000003832
Sequence length 108
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB742973.1:16833:70236:-1 gene:ENSAPLG00000003732 transcript:ENSAPLT00000003832 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
INLRLILVSGKTKEFLFSPNDSAADIAKHVYDNWPMDWEEEQVSSPNILRLIYQGRFLHG
NVTLGALKLPFGKTTVMHLVARETLPEPNSQGQRNREKTGESNCCVIL
Download sequence
Identical sequences A0A093C6Z1 U3I7L2
ENSAPLP00000003233 XP_008945557.1.37566 XP_009481706.1.14425 XP_009950147.1.99599 XP_010174727.1.30499 XP_010198292.1.23224 28377.ENSACAP00000005669

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]