SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000003252 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000003252
Domain Number 1 Region: 280-408
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 7.98e-41
Family Regulator of G-protein signaling, RGS 0.0000252
Further Details:      
 
Domain Number 2 Region: 14-86
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 2.94e-19
Family DEP domain 0.017
Further Details:      
 
Domain Number 3 Region: 204-268
Classification Level Classification E-value
Superfamily Transducin (heterotrimeric G protein), gamma chain 5.75e-19
Family Transducin (heterotrimeric G protein), gamma chain 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000003252   Gene: ENSAPLG00000003719   Transcript: ENSAPLT00000003852
Sequence length 427
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB743275.1:1722342:1767080:1 gene:ENSAPLG00000003719 transcript:ENSAPLT00000003852 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SVLSFLFIFPFCFVVTGADIVQWLMKNLSIEDPGEAIHLGSLIAAQGYVFPISDHVLTLK
DDGTFYRFQAPYFWPSNCWEPENTDYAIYLCKRTMQNKARLELADYEAENLARLQRAFAR
KWEFIFMQAEAQVKIDRKKDKTERKILDSQERAFWDVHRPVPGCVNTTEMDIRKCRRMKN
PQKVKKSVYGVTEESQPQSPVHVPSQPVRKTTKEDFRKQITFLNLQIDRHCLKMSKVAES
LIAYTEQYVEYDPFITPAEPSNPWISDDAALWDIEMRNSKEPSQQRVKRWGFSMDEVLKD
PVGRDQFLRFLESEFSSENLRFWLAVQDLKKQPLQDVTTRVEEIWQEFLAPGAQSAINLD
SHSYEKTSQNVKDPGRYTYEDAQEHIYKLMKSDSYARFLRSNAYQDLLLAKKKVSVGKDM
LASLCTS
Download sequence
Identical sequences U3I7N1
ENSAPLP00000003252

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]