SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000003311 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000003311
Domain Number 1 Region: 270-342,405-612
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.06e-47
Family p120GAP domain-like 0.0012
Further Details:      
 
Domain Number 2 Region: 113-244
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.22e-29
Family Synaptotagmin-like (S variant) 0.0025
Further Details:      
 
Domain Number 3 Region: 568-709
Classification Level Classification E-value
Superfamily PH domain-like 5.6e-29
Family Pleckstrin-homology domain (PH domain) 0.0073
Further Details:      
 
Domain Number 4 Region: 13-128
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.57e-22
Family PLC-like (P variant) 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000003311   Gene: ENSAPLG00000003804   Transcript: ENSAPLT00000003911
Sequence length 804
Comment pep:novel scaffold:BGI_duck_1.0:KB742489.1:875685:880893:-1 gene:ENSAPLG00000003804 transcript:ENSAPLT00000003911 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AASRMLGSGLRSRARRVPAARDXTGSSDPYCIVKIDNEPIIRTATVWKTLSPFWGEEYEV
HLQPTFHSISIYVMDEDALSRDDVIGKVCITRAMLAEHPKGYSGWVSLSEVDPDEEVQGE
IHLCVELLEGEGGRRLRCTVLEARDLAKKDRNGASDPFVRVRYNGKTQESTVVKKSCYPR
WNESFEFELPEPAGEKLCVEVWDWDLVSKNDFLGKVSPKKHRQQGLRAAGRQEGWFRLQP
HSSKPREDGRRGSLGSLQLQLRLRDETVLPSHCYQPLVQLLCQEVKSGCQDGRVHLVTLL
DETTTAECRQEVAVNLVKLFLGQGLVKEFLDLLFELELAKPCKAELGAVPGAPSLLLGLQ
SLCNLAWWFLGAQPSCCALMEEQWFELPEGDPGPSRQPLSPFTGEPNTLFRSNSLASKSX
HLQPHLRELLDTISKSAPTCPPVIRAAFRQLFQRVGERFPEHQHAKFVAVTSFLCLRFFS
PAIMTPKLFHLRDAHADARTSRTLLLLAKAIQMVGNMEPAAGRAKEAWLAPLQPALQQGI
KAFITRLVGTEEEEDGGEGRLRSPPAAVVKEGLLFVHKTRGKGPLLSCAAKKLHFCLTGE
ALSFAKSPGAERIGSIALANIRAAEKVEEKSFGSCHVMQVVYVEENGQQETAYLQCKCVN
ELNQWLSALRKVCGNNPQLLCAYHPGVFRGDKWTCCHQKDRTGLGCDRTRHGVTLQDWSD
PLDPDAEAQRLFQHLHGLQQPLREKYWELVKMEDPQNDPQVCSEGAPVPPGLSQLFEVLQ
DLEGCHRLLSPSPPTSPALLELQT
Download sequence
Identical sequences U3I7U0
ENSAPLP00000003311

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]