SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000003340 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000003340
Domain Number 1 Region: 177-260
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 4.26e-21
Family La domain 0.0000449
Further Details:      
 
Domain Number 2 Region: 254-333
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.0000405
Family Canonical RBD 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000003340   Gene: ENSAPLG00000003813   Transcript: ENSAPLT00000003940
Sequence length 764
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB742395.1:1444729:1480117:-1 gene:ENSAPLG00000003813 transcript:ENSAPLT00000003940 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KVTSKVLSEQPKSRQLMTSDQDTKVVAEPQVQQVQEVKDGSHLVSKSVKQAEFEVHPNET
INKTESAKVSELNPNAKVWGNHMLHLEASGATDGSVSKTWEEVPDQPPDSCKEGLDANGD
SDKKHQNAVLTELQEPSPAVSVSDQTDMNPLALDHSEYESMHETAQTGGNEQLQPEGQED
LRELLKKTLEFCLSRENLASDMYLISQMDSDQYVPIMTVANLDHVKKLSTDMDLIVEVLR
SLPLVQVDEKGEKVRPNQNRCIVILREVPESTPIEEVEALFKGDNLPKFINCEFAYNDNW
FITFESEADAQQAYRYLREEVKTFQGKPIKARIKAKAIAINTFLPKNGYRPLDMNLYTQQ
RYTTSFYLPPVYSPQQQFPLYSLIAPQTWSTTHSYLDPALVTPFPNTGFINGFTSPTFKP
AASPLTTLRQYPPRNRNPSKSHIRHTIPSAERGPGLLDSPTIFNFSADRLINGVRSPQTR
QPGQNRTRMQNATTSYTKREVGTGRMEQTSVDSSPGLGRGRKNSYGYRKKREDKFTRGQT
QSPPPPKPPSPSFELGLSSFPPLPGAAGNLKTEDLFENRLSSVVIGTSKERNVNVDASTN
TIPSGIPREPLLPVSSTLPRTFERSPSPTQPSEDSKVVDKQQRETQSAERLSSSTLSTAC
KSVQVNGAATELRKPSYAEICQRTTKDPPTLQPQKEQKPNTVACGKEEKKPTETIEKNRE
PPPAKSHPGQPKDQRRQSGRRSSPPAVVGKRLNKEQNTPPKSPQ
Download sequence
Identical sequences U3I7W9
ENSAPLP00000003340

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]