SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000003344 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000003344
Domain Number 1 Region: 1-173
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 2.55e-46
Family BCR-homology GTPase activation domain (BH-domain) 0.00051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000003344   Gene: ENSAPLG00000003858   Transcript: ENSAPLT00000003944
Sequence length 182
Comment pep:novel scaffold:BGI_duck_1.0:KB742725.1:222999:226608:-1 gene:ENSAPLG00000003858 transcript:ENSAPLT00000003944 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLSLLYQEGPSTEGIFRRSGSAKTCKELKEKLDSGAEVDLACESIFVTASLFKDKDFLRN
IPGSILSSQLCDKWVSVMDQGNNEEKIKSIQRLIEQLPRANVVLLRYIFGVLHGIEMRSE
ENQMNAFNLAICIAPSLLWPPVSSTPDMESEFTKKISSLVQFLTENCCRIFGEEINSLFG
EI
Download sequence
Identical sequences U3I7X3
ENSAPLP00000003344

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]