SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000003361 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000003361
Domain Number 1 Region: 50-152
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000000422
Family Pleckstrin-homology domain (PH domain) 0.014
Further Details:      
 
Domain Number 2 Region: 163-241
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000000356
Family Ras-binding domain, RBD 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000003361   Gene: ENSAPLG00000003858   Transcript: ENSAPLT00000003961
Sequence length 353
Comment pep:novel scaffold:BGI_duck_1.0:KB742725.1:226591:269729:-1 gene:ENSAPLG00000003858 transcript:ENSAPLT00000003961 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKSLAQRRQSAPSLIFVKALNRSRSVSREGCFSPISPEACPLVQSFMCHNRTFLLDGHVQ
LKTGLQTQERHLFLFTDLLVVAKSKSHSHFKLKCQARLCEMWTAFCTEEVCEGSTDPERS
FVLGWPTTNCVANFRSAEQKETWLSFLQSRIREEKEKDYPKSIPLKIIAKDVGTCAYSKT
LTVTNVDTANDVILMALQQLGISGSEKDYKLWVISGREDAPYPLIGHEYPFGIKISHIRD
AMPHGSKHCACPRQLQGSFLTEQLPQELQCQFVLKPSRLAESPPLHDLSQKSFKRKRSII
NWAFWRGPGTHLDNVPLSSTSAAPGKLFGLLLTAICEDDNLPKPLLDMLSLLY
Download sequence
Identical sequences U3I7Z0
ENSAPLP00000003361

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]