SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000003391 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000003391
Domain Number 1 Region: 591-665,707-925
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.78e-80
Family Protein kinases, catalytic subunit 0.00000000231
Further Details:      
 
Domain Number 2 Region: 2-172
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 9.78e-73
Family Ephrin receptor ligand binding domain 0.00000158
Further Details:      
 
Domain Number 3 Region: 298-502
Classification Level Classification E-value
Superfamily Fibronectin type III 1.05e-34
Family Fibronectin type III 0.00013
Further Details:      
 
Domain Number 4 Region: 925-997
Classification Level Classification E-value
Superfamily SAM/Pointed domain 1.61e-20
Family SAM (sterile alpha motif) domain 0.00044
Further Details:      
 
Domain Number 5 Region: 227-288
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000805
Family Growth factor receptor domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000003391   Gene: ENSAPLG00000003892   Transcript: ENSAPLT00000003991
Sequence length 1002
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB742931.1:383:470823:1 gene:ENSAPLG00000003892 transcript:ENSAPLT00000003991 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SVVLLDTTAALGELGWKTFPLNGWDAITEMDEHNRPIHTYQVCNVMEPNQNNWLRTNWIS
RDAAQKIYVEMKFTLRDCNSIPWVLGTCKETFNLYYMESDESHGLKFKPNQYTKIDTIAA
DESFTQMDLGDRILKLNTEVREVGPINKKGFYLAFQDIGACIALVSVRVYYKKCPFTVRN
LAMFPDTIPRVDSSSLVEVRGSCVKSAEERDTPKLYCGADGDWLVPLGRCICSVGYEELD
GSCHACRPGFYKAFAGNVKCSKCPPHSLTYVEATSVCQCEKGYFRAEKDPPTMACTRPPS
APRNVIFNINETALMLEWSPPSDTGGRKDLTYSVICKKCGSDASQCEICGGGIRFIPRHT
GLINSSVTVLDFVSHVNYTFEIEATNGVSELSFSPKQFTAITVTTDQDAPSLIGMVRKDW
ASQNSIALSWQEPDFPHGAILDYEIKYYEKEHEQLSYSSTRSKAPSVIITGLKPATKYIF
HIRVRTAAGYSGYSQKFEFETGDETSDMAAEQGQILVIATAAVGGFTLLVILTLFFLITG
RCQWYIKAKMKSEEKRRAHLQNGHLRFPGIKTYIDPDTYEDPSLAVHEFAKEIDPSRIRI
ERVIGAGEFGEVCSGRLKTPGKREIPVAIKTLKGGYMDRQRRDFLREASIMGQFDHPNII
RLEGVVTKRSFPTIGVKSLSRFLRAGFLNSILTSHPVSGGGSLPPSISSGRPVMIVVEYM
ENGSLDSFLRKHDGHFTVIQLVGMLRGIASGMKYLSDMGYVHRDLAARNILVNSNLMCKV
SDFGLSRVLEDDPEAAYTTSGGKIPIRWTAPEAIAYRKFSSASDAWSYGIVMWEVMSYGE
RPYWEMSNQDVILSIEEGYRLPAPMGCPASLHQLMLHCWQKERNHRPKFSDIVSFLDKLI
RNPSTLHTLVEDVLVMPDSPGEVPEYPLFVSVSDWLDSIKMGQYKNNFMAAGFTTLDMVS
RMSIDDIRRIGVVLIGHQRRIVSSLQTLRLHMMHIQEKGFHV
Download sequence
Identical sequences U3I820
ENSAPLP00000003391

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]