SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000003415 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000003415
Domain Number 1 Region: 117-308
Classification Level Classification E-value
Superfamily p53-like transcription factors 7.29e-87
Family p53 DNA-binding domain-like 0.000000567
Further Details:      
 
Domain Number 2 Region: 490-556
Classification Level Classification E-value
Superfamily SAM/Pointed domain 1.31e-22
Family SAM (sterile alpha motif) domain 0.0000302
Further Details:      
 
Domain Number 3 Region: 348-388
Classification Level Classification E-value
Superfamily p53 tetramerization domain 0.00000000000275
Family p53 tetramerization domain 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000003415   Gene: ENSAPLG00000003880   Transcript: ENSAPLT00000004016
Sequence length 635
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB742522.1:458413:486448:-1 gene:ENSAPLG00000003880 transcript:ENSAPLT00000004016 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AKMSESSPADEGTTFEHLWSTLEPDSTYFDLPPSSHAGSSEVSNRTEVTMDVFQLRGIND
SVMSQFNLLNNSMDQSIGSRAASASPYSSEHTSNVPTHSPYSQPSSTFDAMSPAPVIPSN
TDYPGPHHFEVTFQQSSTAKSATWTYSPLLKKLYCQIAKTCPIQIKVSTPPPPGTIIRAM
PVYKKAEHVTEVVKRCPNHELGRDFNDGQSAPASHLIRVEGNNLSQYVDDPVTGRQSVMV
PYEPPQVGTEFTTILYNFMCNSSCVGGMNRRPILIIITLEMRDGQVLGRRSFEGRICACP
GRDRKADEDHYREQQALNESAAKNGNANKRTFKQSPQGIPALGTGIKKRRHGEEEMYYVP
VRGRENFEILMKIKESLELVELVPQQLVDSYRQQQQQLLQRQSQLQTPSSYGPVLSPMNK
VHGGGINKLPSVNQLVGQPPQHSSSSAPSLGPMGPGMLNSHPMQPNGEMNGGHSSQSMVS
GSHCTPPPPYNPDPSLVSFLTGLGCPNCIDYFTSQGLQNIYHLQNLSIEDLGALKIPEQY
RMIIWRGLQELKQSHDYGAQQLIRSSSNASTISIGSSGELQRQRVMEAVHFRVRHTITIP
NRGGADEWADFGFDLPDCKSRKQSIKEEFTEGEIN
Download sequence
Identical sequences U3I844
ENSAPLP00000003415

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]