SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000003531 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000003531
Domain Number 1 Region: 474-526
Classification Level Classification E-value
Superfamily UBA-like 0.0000000000000114
Family UBA domain 0.0016
Further Details:      
 
Domain Number 2 Region: 1-56
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000000000000484
Family Ubiquitin-related 0.00028
Further Details:      
 
Domain Number 3 Region: 146-219
Classification Level Classification E-value
Superfamily ARM repeat 0.0000224
Family Mo25 protein 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000003531   Gene: ENSAPLG00000004014   Transcript: ENSAPLT00000004132
Sequence length 530
Comment pep:novel scaffold:BGI_duck_1.0:KB745540.1:12547:26578:1 gene:ENSAPLG00000004014 transcript:ENSAPLT00000004132 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FKEEISKRFKSHADQLVLIFAGKILKDQDTLIQHGIHDGLTVHLVIKTQNRSQDHPAQQT
HATGSTATASISSSNTSTSTSTNSNSFGLGGLGSLASLSSLGLNVSNFSELQSQMQQQLM
SNPEVMVQIMENPFVQSMLSSPDLMRQLIMANPQMQQLIQRNPEISHMLNNPDIMRQTLE
LARNPAMMQEMMRNQDRTNIVTAAFKIKHFFRIFTLAYFRMVSIVDQEFGGNPFASLVSN
ASSGGDSQPSRTENRDPLPNPWAPQSSSQSSTTASTSGESSGGSNVGNSTSASMRQSSTI
PNLGPGLGVGMFNTPGMQSLLQQITENPQLMQNMLSAPYMRSMMQSLSQNPDLAAQMMLN
NPLFAGNPQLQEQMRQQLHTYLQQMQSPDTLSAMSNSRAMQALLQIQQGLQTLATEAPGL
IPGFNPGLGGFGSTGVPTGSTVPSSIPSENTSLASGAIEPGHQQFVQQMLQALAGANVQQ
LQNPEVRFQQQLEQLNAMGFLNHEANLQALIATGGDISAAIERLLGSQPS
Download sequence
Identical sequences U3I8G0
ENSAPLP00000003531

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]