SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000003628 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000003628
Domain Number 1 Region: 83-252,338-503,531-646
Classification Level Classification E-value
Superfamily Ras GEF 3.4e-112
Family Ras GEF 0.00025
Further Details:      
 
Domain Number 2 Region: 764-858
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.68e-40
Family Ras-binding domain, RBD 0.00000867
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000003628   Gene: ENSAPLG00000004044   Transcript: ENSAPLT00000004231
Sequence length 889
Comment pep:novel scaffold:BGI_duck_1.0:KB742651.1:1655690:1676879:-1 gene:ENSAPLG00000004044 transcript:ENSAPLT00000004231 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GSRFSRVTGAXVRLEVAGESSPVVLHSFTQLDPDLPPLESSTQEIGEELEDGVIYSISLR
KVQLHHTANKGQRWLGFENESALNLYETCKVRTIKAGTLEKLVEYLVSAFKGNDSTYVTI
FLCTYRAFATTKQVLDLLLNRPGELQHLLPHGGGLMGFSQPHQHEGFGDGAEEGSTISSI
LGAWLDQYSEDFRKPPDFACLKQLISYVRHNIPGSDLERRARILLAQFQQQEQSETEAEG
VFGATGRAVLVSTEGLQSLWSHHMAKTPVNTACVYLETHWEANPAELEVKMPVLLPGPSL
LEQTETRSSEVGCGCLQGWHGIFLPFLTAVEHGGCTFQLVEENGVGDGKSDFLSFSPEMV
AEQFTLMDAELFKKVVPYHCLGCIWSQRDKKGKEHLAPTIRATVSQFNSVANCVIATCLG
DRSLKPQQRAKVVERWIEVARECRLLKNFSSLRAILSALQCNAVHRLKKTWDEVLRRESF
RTFHELSEIFSDENNHSLSRELLIKEGTSKFATLEINPKRAQKRQQQQREMGVMQGTIPY
LGTFLTDLVMLDTAMKDFLDGGLINFEKRRKEFEVIAQIKLLQSACNNYSFTQEDHFVDW
FHSLERLSEAESYGLSCEIEPLSESASNTLKAKKNTGIIKRWSDRQPPSSEPCASGSSHS
KSFDQLKCGQYLCSGDATDSVSVTSAGSSSSDVEEINISFIPESPDCQEKKFWESTSLSS
LDTSGIGSGSSSASSSSVSSTPVTASRTHKRSVSGISSYSSLSLPLYNQQVDDCCIIRVS
LAVDNGNMYKSILVTSQDKTPVVIRKAMAKHNLDGDRPEDYELVQIISEERELKIPDNAN
VFYAMNSAANYDFVLKKRGFSKGVKIKHGSSSTLPRMKQKGLKIAKGIF
Download sequence
Identical sequences U3I8Q7
ENSAPLP00000003628

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]