SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000003639 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000003639
Domain Number 1 Region: 185-329
Classification Level Classification E-value
Superfamily PH domain-like 2.98e-38
Family Third domain of FERM 0.00045
Further Details:      
 
Domain Number 2 Region: 78-187
Classification Level Classification E-value
Superfamily Second domain of FERM 5.5e-27
Family Second domain of FERM 0.0001
Further Details:      
 
Domain Number 3 Region: 3-83
Classification Level Classification E-value
Superfamily Ubiquitin-like 7.85e-22
Family First domain of FERM 0.00084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000003639   Gene: ENSAPLG00000004143   Transcript: ENSAPLT00000004242
Sequence length 695
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB743294.1:177787:188099:1 gene:ENSAPLG00000004143 transcript:ENSAPLT00000004242 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLHLKVQFLDDSQKIFVVDQKSCGRGLFNLTCSHLNLVEKEYFGLEFRSQAGNHVWLEPL
KPITKQVKNPKEVLFKFMVKFFPVDPGHLREELTRYLFTLQIKKDLALGRLPCSDKSAAL
LVSHLLQSELGDFHEETDQQHLATHRYLPNQEYLDNKIMHYHRRHGGKTPAESDVQLLDV
ARKLEMYGIRPHPASDGEGTQINLAVTHMGVLVLRGNTKINTFNWSKIRKLSFKRKHFLI
KLHANISALCKDTLEFTMASRDACKAFWKTCVEYHAFFRLSEEPKSKPKALLCSKGSSFR
YSCSGRTQRQLLEHGRKAKMKSLPFERKHHASRYDERQCRSSPDLLTDVSKQVEELRLAY
GSRGSFRTANGVHTSEPTLDSSTTEVTFAAELERSKPEAAPVFLPHSKSSSAFPLLYAEL
ELERAWEPTDLFGSRNPLTSFRPHHKFAGNSKSTSVGNMREVSTRPLVYMDVPCPQPLAT
LAPQVLFYVDRPPQPLCHMQTPSQEAAGAASGSVPTATKTPKWSPSTAWTGEFQHEASHR
AAGSSAAPEGGSRPLARSFDYGLQEQPPKRSWSQSDMKTIRFPYGSEFRPLGPRPALSSR
KAGILRHALAQQGLAPRPRHPAERYVGSSTESSDSDSDLLAAEYCSLYGRVLRSPMARVR
LSSGSLQLEEEDEEVSFATGAAEERTSRGASRYFT
Download sequence
Identical sequences U3I8R8
ENSAPLP00000003639

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]