SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000003756 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000003756
Domain Number 1 Region: 196-323
Classification Level Classification E-value
Superfamily PH domain-like 1.23e-42
Family Third domain of FERM 0.000000381
Further Details:      
 
Domain Number 2 Region: 86-195
Classification Level Classification E-value
Superfamily Second domain of FERM 9.16e-38
Family Second domain of FERM 0.000000745
Further Details:      
 
Domain Number 3 Region: 491-578
Classification Level Classification E-value
Superfamily Moesin tail domain 5.62e-32
Family Moesin tail domain 0.00000628
Further Details:      
 
Domain Number 4 Region: 2-84
Classification Level Classification E-value
Superfamily Ubiquitin-like 4.34e-25
Family First domain of FERM 0.00000865
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000003756   Gene: ENSAPLG00000004209   Transcript: ENSAPLT00000004362
Sequence length 578
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB743210.1:141138:157691:1 gene:ENSAPLG00000004209 transcript:ENSAPLT00000004362 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QISVRVTTMDAELEFAIQPNTTGKQLFDQVVKTIGLREVWFFGLQYQDTKGFSTWLKLNK
KVTAQDVRKESPLLFKFRAKFYPEDVAEELIQDITQRLFFLQVKEAILNDDIYCPPETAV
LLASYAVQSKYGDFNKEVHKSGYLASDKLLPQRVLEQHKLNKDQWEERIQVWHEEHRGMI
REDAVLEYLKIAQDLEMYGVNYFNIKNKKGSELWLGVDALGLNIYEQNDRLTPKIGFPWS
EIRNISFNDKKFVIKPIDKKAPDFVFYAPRLRINKRILALCMGNHELYMRRRKPDTIEVQ
QMKAQAREEKHQKQMESTLIFLSQKQGKFLSASVDLMIEREKEELMERLKQIEEQTKKAQ
QELEEQTRRAMELEQERKRAQEEAEKLAKERREAEEAKEALLKASHDQQKTQEQLAAEMA
ELTARITQLELARQKKESEAQEWQQKAQMVQEDLEKTKEELKTAMSTPHVTEPMQSENEH
DDEQDENAAEASAELRSEATIKDRSEEQRTTEAEKNERVQKHLKALSSELANARDETKKT
ANDMIHAENMRLGRDKYKTLRQIRQGNTKQRIDEFESM
Download sequence
Identical sequences U3I935
ENSAPLP00000003756

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]