SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000003813 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000003813
Domain Number 1 Region: 491-656
Classification Level Classification E-value
Superfamily A middle domain of Talin 1 2.75e-70
Family A middle domain of Talin 1 0.000000312
Further Details:      
 
Domain Number 2 Region: 757-892
Classification Level Classification E-value
Superfamily I/LWEQ domain 3.14e-53
Family I/LWEQ domain 0.00000188
Further Details:      
 
Domain Number 3 Region: 2298-2488
Classification Level Classification E-value
Superfamily I/LWEQ domain 3.63e-51
Family I/LWEQ domain 0.00012
Further Details:      
 
Domain Number 4 Region: 666-786
Classification Level Classification E-value
Superfamily I/LWEQ domain 7.06e-50
Family I/LWEQ domain 0.00000538
Further Details:      
 
Domain Number 5 Region: 1841-1975
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 3.37e-46
Family VBS domain 0.00000668
Further Details:      
 
Domain Number 6 Region: 1228-1364
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 8.63e-42
Family VBS domain 0.024
Further Details:      
 
Domain Number 7 Region: 197-311
Classification Level Classification E-value
Superfamily Second domain of FERM 1.83e-31
Family Second domain of FERM 0.00000145
Further Details:      
 
Domain Number 8 Region: 1077-1210
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 3.14e-28
Family VBS domain 0.012
Further Details:      
 
Domain Number 9 Region: 312-402
Classification Level Classification E-value
Superfamily PH domain-like 1.4e-24
Family Third domain of FERM 0.0000172
Further Details:      
 
Domain Number 10 Region: 1473-1558
Classification Level Classification E-value
Superfamily I/LWEQ domain 0.0000000000000405
Family I/LWEQ domain 0.0087
Further Details:      
 
Domain Number 11 Region: 1699-1817
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 0.0000000534
Family VBS domain 0.045
Further Details:      
 
Domain Number 12 Region: 81-136
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000000875
Family Ubiquitin-related 0.062
Further Details:      
 
Domain Number 13 Region: 2008-2135
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 0.00000565
Family VBS domain 0.016
Further Details:      
 
Domain Number 14 Region: 947-1045
Classification Level Classification E-value
Superfamily I/LWEQ domain 0.0000471
Family I/LWEQ domain 0.0043
Further Details:      
 
Weak hits

Sequence:  ENSAPLP00000003813
Domain Number - Region: 1586-1662
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 0.000267
Family VBS domain 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000003813   Gene: ENSAPLG00000004060   Transcript: ENSAPLT00000004420
Sequence length 2544
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB744306.1:1070042:1169430:-1 gene:ENSAPLG00000004060 transcript:ENSAPLT00000004420 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVALSLKICVRQCNVVKTMQFEPSTAVYDACRVIRERVPEAQMGQASDYGLFLSDEDPRK
GIWLEAGRTLDYYMLRNGDILEYKKKQRPQKIRMLDGSVKTVMVDDSKTVGELLVTICSR
IGITNYEEYSLIQESIEEKKEESTGTLKKDRTLLRDERKMEKLKAKLHTDDDLNWLDHSR
TFREQGVDENETLLLRRKFFYSDQNVDSRDPVQLNLLYVQARDDILNGSHPVSFEKACEF
GGFQAQIQFGPHVEHKHKPGFLDLKEFLPKEYTKQRGAEKRIFQEHKNCGEMTEIEAKVK
YVKLARSLRTYGVSFFLVKEKMKGKNKLVPRLLGVTKDSVMRVDEKTKEVLQEWPLTTVK
RWAASPKSFTLDFGEYQESYYSVQTTEGEQISQLIAGYIDIILKKKQSKDRFGLEGDEES
TMLEESVSPKKSTILQQQFNRTGKVEHGSVALPAVMRSGSSGPETFNIGIMPSPQQQVTI
GQMHRGHMPPLTSAQQALMGTINTSMHAVQQAQADLSEVDNLPPLGQDMASRVWVQNKVD
ESKHEIHSQVDAITAGTASVVNLTAGDPVDTDYTAVGCAITTISSNLTEMSKGVKLLAAL
MDDEVGSGEDLLKAARTLASAVSDLLKAVQPTSGEPRQTVLTAAGSIGQASGELLRQIGE
NETDERFQQDVLMSLAKAVANAAAMLVLKAKNVAQVAEDTVLQNRVIAAATQCALSTSQL
VACAKVVSPTISSPVCQEQLIEAGKLVDRSVENCVRACQAATDDTELLKQVGAAASIVSQ
ALNDLLQHVRQFASRGEPIGRYDQATDTIMCVTESIFSSMGDAGEMVRQARVLAQATSDL
VNAMRSDAEAEIDMDNSKKLLAAAKLLADSTARMVEAAKGAAANPENEDQQQRLREAAEG
LRVATNAAAQNAIKKKIVNRLEIAAKQAAAAATQTIAASQNAAVSNKNTAAHQQLVQSCK
NVADHIPQLVQGVRGSQAQAEDLSAQLALINSSQNFLQPGSKMVASAKAAVPTVTDQAAA
MQLSQCAKNLATSLAELRTASQKAHEACGPMEIDSALNTVQTLKNELQDAKMAAVDGQLK
PLPGETLEKCAQDLGSTSKAVGSSMAQLLTCAAQGNEHYTGVAARETAQALKTLAQAARG
VAASTTDPVAAHAMLDSARDVMEGSAMLIQEAKQALAAPGDADSQQRLAQVAKAVSHSLN
NCVNCLPGQKDVDVALKSIGESSKKLLVDLLPPSSKSFQEAQSELNQAAADLNQSAGEVV
HATRGQSGELAAASGKFSDDFDEFLDAGIEMAGQAQTKEDQIQVIGNLKSISMASSKLLL
AAKSLSVDPGAPNAKNLLAAAARAVTESINQLITLCTQQAPGQKECDNALRELETVKGML
DNPNEPVSDLSYFDCIEGVMENSKVLGESMAGISQNAKTGDLLVFGECVGVASKALCGLT
EAAAQAAYLVGISDPNSQAGQQGLVDPIQFARANQAIQMACQNLVDPASSPSQVLSAATI
VAKHTSALCNACRIASSKTANPVAKRHFVQSAKEVANSTANLVKTIKALDGDFSEENRNK
CRIATAPLIEAVENLTAFASNPEFVSIPAQISTEGSRAQEPILISAKTMLESSSLLIKTA
RSLAINPKDPPTWSVLAGHSHTVSDSIKSLITSIRDKAPGQRECDYSIDGINRCIRDIEQ
ASLAAVSQSLATRDDISVEALQEQLTSVVQEIGHLIDPIATAARGEAAQLGHKVTQLASY
FEPLVLAAVGVASKTLDHQQQMTVLDQSKTLAESALQMLYAAKEGGGNPKASHTHDAITE
AAQLMKEAVDDIMVTLNEAASEVGMVGGMVDSIAEAMSKLDEGTPADPKGTFVDYQTTVV
KYSKAIAVTAQEMMTKSVTNPEELGGLASQMTNDYGHLALQGRMAAATAEPEEIGFQIKT
RVQELGHGCIFLVQKAGALQICPTDSYTKRELIECARAVTEKVSLVLSALQAGNKGTQAC
ITAASAVSGIIADLDTTIMFATAGTLNAENNESFADHSRENILKTAKALVEDTKLLVSGA
ASSQDKLAQAAQSSANTITQLAEVVKLGAASLGSDDPETQVVLINAIKDVAKALSDLIGA
TKGAASKPADDPSMYQLKGAAKVMVTNVTSLLKTVKAVEDEATRGTRALEATIEYIKQEL
TVFQSNEVPEKTSSPEESIRMTKGITMATAKAVAAGNSCRQEDVIATANLSRKAVADMLT
ACKQASYHQEVSEEVRERALRFGTECTLGYLELLEHVLLILQKPTPELKHQLSAFSKRVA
GAVTELIQSAEAMKGTEWVDPEDPTVIAETELLGAAASIEAAAKKLEQLKPRAKPKQADE
TLDFEEQILEAAKSIAAATSALVKSASAAQRELVAQGKVGAIPANAADDGQWSQGLISAA
RMVAAATSNLCEAANASVQGHASEEKLISSAKQVAASTAQLLVACKVKADHDSEAMRRLQ
AAGNAVKRASDNLVRAAQKAAFGKAEDDDVVVKTKFVGGIAQIIAAQEEMLKKERELEEA
RKKLAQIRQQQYKFLPTELREDEG
Download sequence
Identical sequences U3I992
ENSAPLP00000003813

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]