SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000003818 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000003818
Domain Number 1 Region: 507-620
Classification Level Classification E-value
Superfamily SH2 domain 4.31e-32
Family SH2 domain 0.000000771
Further Details:      
 
Domain Number 2 Region: 195-283
Classification Level Classification E-value
Superfamily Ubiquitin-like 4.48e-28
Family Ras-binding domain, RBD 0.00017
Further Details:      
 
Domain Number 3 Region: 314-429
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000000063
Family Pleckstrin-homology domain (PH domain) 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000003818   Gene: ENSAPLG00000004267   Transcript: ENSAPLT00000004425
Sequence length 623
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB743400.1:573881:682534:-1 gene:ENSAPLG00000004267 transcript:ENSAPLT00000004425 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LVNDMNSSFESLYSTCSMQSETTPLLQNGQLNRSQLPTSGSGALQPMSPRQKVQRSQPVR
IMAVRRLQEEEQQFRTSSLPAIPNPFPELCSPASSPVLAPGSLPQSQPASKHHCWRCHSM
HGAEGVRQHNGRCKIWKLQASEGIQLSKITWVGFYSLSFKRKKKSDAGQKCQTNFLNPLF
RREPARSRREIILQQDVKVFSEDGTSKVVEILADMTARDLCQLLVYKSHCVDDNSWTLVE
HHPHLGLERCLEDHELIVQVESTMGSESKFLFRKNYAKYEFFKNPMNFFPEQMVAWCQQT
NGSIPQSQLLQNFLNSSSCPEIQGFLHVKELGRKSWKKLYVCLRRSGLYCSTKGTSKEPR
HLQLLADLEDSNIFSLIAGKKLYNAPAEYGFCIKPNRVRNETKELRLLCAEDEQSRTCWM
TAFRLLKYGMLLYQNYRIPQQRKAMLPHFATPVRSVSENSLVAMDFSGQIGRVIENPAEA
QSAALEEGHAWRKRSTRMNILGSQSPLHPSTLSTVIHRTQHWFHGRISREESHRIIKQQG
LVDGLFLLRDSQSNPKAFVLTLCHHQKIKHFQILPCEDDGQIFFSLDDGNTKFSDLIQLV
EFYQLNKGVLPCKLKHHCIRVAL
Download sequence
Identical sequences U3I997
ENSAPLP00000003818

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]