SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000003999 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000003999
Domain Number 1 Region: 305-407
Classification Level Classification E-value
Superfamily ARID-like 5.1e-33
Family ARID domain 0.0004
Further Details:      
 
Domain Number 2 Region: 572-692
Classification Level Classification E-value
Superfamily Chromo domain-like 3.85e-21
Family Chromo barrel domain 0.011
Further Details:      
 
Domain Number 3 Region: 59-113
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 0.0000000000383
Family Tudor domain 0.017
Further Details:      
 
Weak hits

Sequence:  ENSAPLP00000003999
Domain Number - Region: 191-285
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 0.00923
Family Tudor domain 0.082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000003999   Gene: ENSAPLG00000004422   Transcript: ENSAPLT00000004606
Sequence length 1323
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB743543.1:146812:204505:-1 gene:ENSAPLG00000004422 transcript:ENSAPLT00000004606 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FQAIDEPPYLTVGTDVSAKYRGAFCEAKIKTAKRLVKVKVTFRHDSSTVEVQDDHIKGPL
KVGTVVEVKNPDGTYQEAVINKLTDASWYTVVFDDGDEKTLRRSSLCLKGERHFAESETL
DQLPLTNPEHFGTPVIGKKTNRGRRSNHIPEEESSSSSSDEDEDDRKQSDELLGKVVCVD
CFSVDKKKALWFPALVVCPDCSDDIAVKKDNILVRSFKDGKFVSVPRKDVREISETSPKP
DALLKQAFDQALEFHKNRTVPSNWKTELKEDSSSNNSSEEEASEDAEKECENPIFACEIQ
EEIEPFPEERENFLQQLYKFMEDRGTPINKRPVLGYRNLNLFKLFRLVHKLGGFDNIESG
AVWKQVYQDLGIPVLNSAAGYNVKCAYKKYLYGFEEYCTSANIEFQMALPEKVTSKPCKD
CEKEKELKMREDPEQDVKEIKADKEERKQEEVAAVQQEDKKLAENDNESKENDKPTVTGN
RKNLPDSAHIQPDQEKDLNVIKTEDETKAEDKEEEKIKEMENPTANTEAEEKEKSGNGLP
TNKKERLSAENLEEDDCFQNKIEVTSDFHNNNDEEEFECYPPGMKVQVRYGRGKNQKMYE
ASIKDSDIEGGEVLYLVHYCGWNVRYDEWIKADKIVRPADKNVPKIKHRKKIKNKTDKEK
EEKYSPKNCKLRRLSKPPFHTSTSPETGSKLDSAEAKNTEQAPVKSVEITSIINGLQAAS
ESSDDSEQEDDQSAQNVHTDGKEESQHEAVSQDKNELCLKEEQSSSALPEETKALTDAVV
PKSGSKSPERLRKEMEELSEDTDSDGEDEATKKRKEVKREVADKTAKPQVKRGKRRYCVT
EESLKTVSPNRKDEKSKNKDSLSLENSSNSSSDEDEEDKAKLKITPTKKYNGLEEKRKSL
RTGTFYSGFSEVAEKRIKLLNNSDERLQNTRAKDRKDVWSSIQGQWPKKTLKELFSDSDT
EAAASPPHAAPEDAAAEEQLQTLAEEDISLPSSELEKPLPASADVKPVEEKPAEMGEKKV
EFPSSGSNSVLNTPPTTPESPSSVTVTDSRHQSSVTVSETLPPNQEEIRSIKSETDSTIE
VDSVAGELQDLQSEGNISPTGFDASVSSSSSNQPEPEHTEKVCAGQKRLKDAQGGGSSSK
KQKRSHKTSSVNNKKKSKTTNSSDSEELSAGESLSKSQPAKSVSTGMKSHQTKSPARTQS
PGKCGKNGEKESDLKEQNNRLPKVYKWSFQMSDLENLTSAERITVLQEKLQEIRKHYLSL
KSEVASIDRRRKRLKKKERESAATTSSSSSSPSSSSITAAVMLTLAEPSMSSSSQNGMSV
ECR
Download sequence
Identical sequences U3I9S8
ENSAPLP00000003999

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]