SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000004000 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000004000
Domain Number 1 Region: 340-416
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 8.7e-19
Family PCI domain (PINT motif) 0.027
Further Details:      
 
Domain Number 2 Region: 124-187,234-344
Classification Level Classification E-value
Superfamily TPR-like 0.00000202
Family Tetratricopeptide repeat (TPR) 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000004000   Gene: ENSAPLG00000004440   Transcript: ENSAPLT00000004607
Sequence length 444
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB743097.1:457363:470442:1 gene:ENSAPLG00000004440 transcript:ENSAPLT00000004607 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NKCVDRQVVVDGKAGLEMEEYSEDSNSEPNVDLENQYYNSKALKEDDPKAALSSFQKVLE
LEGEKGEWGFKALKQMIKINFKLTNFPEMMNRYKQLLTYIRSAVTRNYSEKSINSILDYI
STSKQMDLLQEFYETTLEALKDAKNDRLWFKTNTKLGKLYLEREEYGKLQKILRQLHQSC
QTDDGEDDLKKGTQLLEIYALEIQMYTAQKNNKKLKALYEQSLHIKSAIPHPLIMGVIRE
CGGKMHLREGEFEKAHTDFFEAFKNYDESGSPRRTTCLKYLVLANMLMKSGINPFDSQEA
KPYKNDPEILAMTNLVSAYQNNDIAEFEKILKTNHSNIMDDPFIREHIEELLRNIRTQVL
IKLIKPYTRIHIPFISKELNIDVADVESLLVQCILDNTIHGRIDQVNQLLELDHQKRGGA
RYTALDKWTNQLNSLNQAVVSKLA
Download sequence
Identical sequences U3I9S9
ENSAPLP00000004000

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]