SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000004009 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000004009
Domain Number 1 Region: 1826-2000
Classification Level Classification E-value
Superfamily Sec63 N-terminal domain-like 2.09e-60
Family Sec63 N-terminal domain 0.0000000202
Further Details:      
 
Domain Number 2 Region: 1199-1490
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 7.31e-56
Family Tandem AAA-ATPase domain 0.00041
Further Details:      
 
Domain Number 3 Region: 995-1167
Classification Level Classification E-value
Superfamily Sec63 N-terminal domain-like 9.94e-53
Family Sec63 N-terminal domain 0.00064
Further Details:      
 
Domain Number 4 Region: 661-873
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.83e-48
Family Tandem AAA-ATPase domain 0.00094
Further Details:      
 
Domain Number 5 Region: 398-651
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 6.39e-45
Family Tandem AAA-ATPase domain 0.00022
Further Details:      
 
Domain Number 6 Region: 1499-1708
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.05e-41
Family Tandem AAA-ATPase domain 0.001
Further Details:      
 
Domain Number 7 Region: 2001-2113
Classification Level Classification E-value
Superfamily E set domains 1.82e-32
Family Sec63 C-terminal domain-like 0.000000928
Further Details:      
 
Domain Number 8 Region: 1708-1809
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.0000000462
Family RecQ helicase DNA-binding domain-like 0.074
Further Details:      
 
Domain Number 9 Region: 873-978
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.000000816
Family RecQ helicase DNA-binding domain-like 0.085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000004009   Gene: ENSAPLG00000004313   Transcript: ENSAPLT00000004616
Sequence length 2121
Comment pep:novel scaffold:BGI_duck_1.0:KB743182.1:85096:105243:1 gene:ENSAPLG00000004313 transcript:ENSAPLT00000004616 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NSNLVLQADRSLIDRTRRDEPTGEVLSLVGKLEGTRMGDKAQRTKPQMQEERRAKRRKRD
EDRHDINKMKGYTLLSEGIDEMVGIIYKPKTKETRETYEVLLSFIQAALGDQPRDILCGA
ADEVLAVLKNEKLRDKERRKEIDLLLGQTDDTRYHVLVNLGKKITDYGGDKEIQNMDDNI
DETYGVNVQFESDEEEGDEDIYGEVRDEASDDDMEGDEAVVRCTLSANLVASGELMSSKK
KDLHPRDIDAFWLQRQLSRFYDDAIVSQKKADEVLEILKTASDDRECENQLVLLLGFNTF
DFIKVLRQHRMMILYCTLLASAQSEAEKERIMGKMEADPELSKFLYQLHETEKEDLIREE
RSRRERVRQSRMDTDLETMDLDQGGEALAPRQVLDLEDLVFAQGSHFMANKRCQLPDGSF
RRQRKGYEEVHVPALKPKPFGSEEQLVSVEKLPKYAQAGFEGFKTLNRIQSKLYRAALES
DENLLLCAPTGAGKTNVALMCMLREIGKHINMDGTINVDDFKIIYIAPMRSLVQEMVGSF
GKRLATYGINVAELTGDHQLCKEEISATQIIVCTPEKWDIITRKGGERTYTQLVRLVILD
EIHLLHDDRGPVLESLVARAIRNIEMTQEDVRLVGLSATLPNYEDVATFLRVDPAKGLFY
FDNSFRPVPLEQTYVGITEKKAIKRFQIMNEIVYEKIMEHAGKNQVLVFVHSRKETGKTA
RAIRDMCLEKDTLGLFLREGSASTEVLRTEAEQCKNLELKDLLPYGFAIHHAGMTRVDRT
LVEDLFADKHIQVLVSTATLAWGVNLPAHTVIIKGTQVYSPEKGRWTELGALDILQMLGR
AGRPQYDTKGEGILITSHGELQYYLSLLNQQLPIESQMVSKLPDMLNAETVLGNVQNAKD
AVNWLGYTYLYIRMLRSPTLYGISHDDLKGDPLLDQRRLDLVHTAALMLDKNNLVKYDKK
TGNFQVTELGRIASHYYITNETMQTYNQLLKPTLSEIELFRVFSLSSEFRNITVREEEKL
ELQKLLERVPIPVKESIEEPSAKINVLLQAFISQLKLEGFALMADMVYVTQSAGRLMRAI
FEIVLNRGWAQLTDKTLNLCKMIDKRMWQSMCPLRQFKKLPEEVVKKIEKKNFPFERLYD
LNHNEIGELIRMPKMGKTIHKYVHLFPKLELSVHLQPITRSTLKVELTIAPDFQWDEKVH
GSSEAFWILVEDVDSEVILHHEYFLLKAKYAQDEHLVTFFVPVFEPLPPQYFIRVVSDRW
LSCETQLPVSFRHLILPEKYPPPTELLDLQPLPVSALRNSAFESLYQDKFPFFNPIQTQV
FNTVYNSDDNVFVGAPTGSGKTICAEFAILRMLLQNSEGRCVYITPMEALAEQVFMDWYE
KFQERLNKKVVLLTGETSTDLKLLGKGNIIISTPEKWDILSRRWKQRKNVQNVNLFIVDE
VHLIGGENGPVLEVICSRMRYISSQIERPIRIVALSSSLSNAKDVAHWLGCSATSTFNFH
PNVRPVPLELHIQGFNISHTQTRLLSMAKPVYHAIMKHSPKKPVIVFVPSRKQTRLTAIN
ILTTCASDVQRQRFLHCAEKDLVPYLDKLNDNTLKETLVNGVGYLHEGLTAMERRVVEQL
FSSGAVQVMVASRSLCWGMNIAAHLVIIMDTQYYNGKIHAYVDYPIYDVLQMVGHANRPL
QDDEGRCVIMCQGSKKDFFKKFLYEPLPVESHLDHCMHDHFNAEIVTKTIENKQDAVDYL
TWTFLYRRMTQNPNYYNLQGVSHRHLSDHLSELVEQTLSDLEQSKCISIEDEMDVAPLNL
GMIAAYYYINYTTIELFSMSLNAKTKVRGLIEIISNAAEYENIPIRHHEDNLLRQLAQKV
PHKLTNPKFNDPHVKTNLLLQAHLSRMQLSAELQSDTEEILSKAIRLIQACVDVLSSNGW
LSPALAAMELAQMVTQAMWSKDSYLKQLPHFTSEHIKRCTDKGVESVFDIMEMEDEDRNA
LLQLSDAQIADVARFCNRYPNIELSYEVVEKESIRSGGPVVVLVQLEREEEVTGPVIAPL
FPQKREEGWWVVIGDSKSNSLISIKRLTLQQKAKVKLDFVAPATGTHNYTLYFMSDAYMG
CDQEYKFSVDVKEAESDSDSD
Download sequence
Identical sequences R0LG86
ENSAPLP00000004009

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]