SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000004067 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000004067
Domain Number 1 Region: 2-357
Classification Level Classification E-value
Superfamily SAICAR synthase-like 6.47e-123
Family Phosphatidylinositol phosphate kinase IIbeta, PIPK IIbeta 0.0000000000253
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000004067   Gene: ENSAPLG00000004521   Transcript: ENSAPLT00000004674
Sequence length 358
Comment pep:novel scaffold:BGI_duck_1.0:KB746063.1:24761:73539:-1 gene:ENSAPLG00000004521 transcript:ENSAPLT00000004674 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
INELSHVQIPVMLMPDDFKAYSKIKVDNHLFNKENMPSHFKFKEYCPMVFRNLRERFGID
DQDFQNSLTRSAPLANDSQARSGARFHTSYDKRYIIKTITSEDVAEMHNILKKYHQFIVE
CHGNTLLPQFLGMYRLTVDGVEIYMIVTRNVFSHRLSVYRKYDLKGSTVAREASDKEKAK
ELPTFKDNDFINDGQKIHIDENNKKMFLEKLKKDVEFLAQLKLMDYSLLVGIHDVERAEQ
EEVECEENDGEDEGESDGTHPIGTPPDSPGNTLNSSLPLAPGEFDPAIDVYGIKSHENAP
RKEIYFMAIIDILTHYDAKKKAAHAAKTVKHGAGAEISTVNPEQYSKRFLDFIANILT
Download sequence
Identical sequences R0KWN0
ENSAPLP00000004067

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]