SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000004069 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000004069
Domain Number 1 Region: 1-109
Classification Level Classification E-value
Superfamily Rap30/74 interaction domains 1.02e-27
Family Rap30/74 interaction domains 0.000004
Further Details:      
 
Domain Number 2 Region: 167-234
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 6.53e-25
Family DNA-binding domain from rap30 0.0000398
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000004069   Gene: ENSAPLG00000004535   Transcript: ENSAPLT00000004676
Sequence length 241
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB745334.1:27896:105866:1 gene:ENSAPLG00000004535 transcript:ENSAPLT00000004676 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VPKYLSQQWSKASGRGEVGKLRISKNQGRTEVSFTLNEELASINDIGGKPASVSAPREHP
FLLQSVGGQTLTVFTESSAEGQSDEKSESGSADKLSLEGIVVQRAECRPAASENYMKLKR
RLQIEESSKPVRLSQQLDKAVTTNYKPVANHQYNIEYEKKKKEDGKRARADKQQVLDMLF
SAFEKHQYYNIKDLVDITKQPVIYLKEILREIGIYNVKGTHKNTWELKPEYRHYQVEDKS
D
Download sequence
Identical sequences U3I9Z8
ENSAPLP00000004069

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]