SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000004117 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000004117
Domain Number 1 Region: 263-364
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 8.16e-31
Family ets domain 0.00015
Further Details:      
 
Domain Number 2 Region: 37-123
Classification Level Classification E-value
Superfamily SAM/Pointed domain 1.4e-18
Family Pointed domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000004117   Gene: ENSAPLG00000004607   Transcript: ENSAPLT00000004726
Sequence length 375
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB742726.1:134806:137836:1 gene:ENSAPLG00000004607 transcript:ENSAPLT00000004726 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGSCEISNILSKYNSTMYQQEEPQLALDVLGHPGDDGSLGLSFPPSLPPVDTTETPEWF
SELPYFWTKVQVLEWISYHVEKNKYDASIIDFSCCNMDGHTLCHCSRDQMRHIFGPLGDE
LYDXXXXXXXXPTASDELNWIIDLLEKEDANSQETFLDTSHLELPNPCAKDSLEDLKPTN
PFLFTDITCSPDAMSPGSSDVSGPAMSHSPNSQDSGGSDLDLDPVEAKLFPDDGFAGSKK
GDGKHGKRKRGRPRKLSKENRDCLEGRKSKHSPRGTHLWEFIRDILIHPELNEGLMKWED
XXXXXXXXRSEAVAQLWGQKKKNSSMTYEKLSRAMRYYYKREILERVDGRRLVYKFGKNS
SGWKEEEVLNRNKEL
Download sequence
Identical sequences U3IA46
ENSAPLP00000004117

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]