SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000004145 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000004145
Domain Number 1 Region: 19-109
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 4.35e-26
Family La domain 0.0011
Further Details:      
 
Domain Number 2 Region: 141-203
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.000000787
Family Canonical RBD 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000004145   Gene: ENSAPLG00000004633   Transcript: ENSAPLT00000004754
Sequence length 405
Comment pep:novel scaffold:BGI_duck_1.0:KB744699.1:357951:359414:1 gene:ENSAPLG00000004633 transcript:ENSAPLT00000004754 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SFCDVSDALGAGLFDCSYSVPDPQLVRRIVSQVEFYLSDENLAKDAFLLKHVQKNKMGFV
SIKLLTSFKKVKYLTRDWRLTLYALQFSELLEVNEEGTKVRRRVPLPESLLSIPPSKLLL
AWDPLPQELGMLLPLQKNFIETITRMFSPFGAIASIRILRPGRKLPSDVRKYTVRFPELL
SRCCALVEYESLESARRAFEDLSRPGSASIRVVRLSGKGSKKSVTEREAAAVEETLGWKA
QAVAAEMFPYSLEDSLLCSSLESDTAQASLPLLLSTPSRPDGHSGFKPGSFGSTFTRSLL
ASKVFPPLTTELSTGGCFGLGSSPESSQGLDFGWGSGVGAWTPWGGSITPDPSLDAKSPP
GNPLAVKQVSESLGLCAGVLRLPHGPDGTKGFYNSIGRGKLVLKH
Download sequence
Identical sequences U3IA74
ENSAPLP00000004145

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]