SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000004356 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000004356
Domain Number 1 Region: 118-296
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.96e-39
Family BCR-homology GTPase activation domain (BH-domain) 0.000000469
Further Details:      
 
Domain Number 2 Region: 614-720
Classification Level Classification E-value
Superfamily SH2 domain 2.83e-32
Family SH2 domain 0.000000963
Further Details:      
 
Domain Number 3 Region: 303-438
Classification Level Classification E-value
Superfamily SH2 domain 3.64e-30
Family SH2 domain 0.0000011
Further Details:      
 
Domain Number 4 Region: 4-83
Classification Level Classification E-value
Superfamily SH3-domain 9.19e-17
Family SH3-domain 0.00000622
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000004356   Gene: ENSAPLG00000004772   Transcript: ENSAPLT00000004972
Sequence length 723
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB742448.1:1039592:1090140:1 gene:ENSAPLG00000004772 transcript:ENSAPLT00000004972 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSAEGYQYRALYDYKKEREEDIDLHLGDILTVNKGTLLALGFSEGEEAKPDEIGWLNGFN
ETTGERGDFPGTYVEYIGRKKISPPTPKPRPPRPLPVAPSPAKAEAETEQQAAFSLPDLT
EQFSPPDVAPPILIKIVETIEKKGLECSTLYVTQGSSSSAELRQILECDASSLDLETFDV
HTLSDALKRYLLDLPNPIIPAAVYSDMISVAQEVQSSEEYAQLLKKLIRSPNIPPQYWLT
LQYLLKHFLRLCQASSKNLLNARSLAEIFSPLLFKFQIASSDNTEHHIKILEVLITSEWN
ERQPVPALPPKPPKPNTVTNNGMNNNMSLQDAEWYWGDISREEVNEKLRDTADGTFLVRD
ASTKMHGDYTLTLRKGGNNKLIKIFHRDGKYGFSDPLTFNSVVELINHYRNESLAQYNPK
LDVKLLYPVSKYQQDQVVKEDSIEAVGKKLHEYNTQFQEKSREYDRLYEDYTRTSQEIQM
KRTAIEAFNETIKIFEEQCQTQERYSKEYIEKFKREGNEKEIQRIMHNYEKLKSRISEIV
DXRLEEDLKKQAAEYREIDKRMNSIKPDLIQLRKTRDQYLMWLTQKGVRQKTHPEGISSR
SLQHQYSMVDDDEDLPHHDERTWNVGNINRSQAENLLRGKRDGTFLVRESSKQGCYACSV
VVDGEVKHCVINKTPTGYGFAEPYNLYNSLKELVLHYQHTSLVQHNDSLNVTLAYPVYAQ
QRR
Download sequence
Identical sequences U3IAT4
ENSAPLP00000004356

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]