SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000004534 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000004534
Domain Number 1 Region: 7-128
Classification Level Classification E-value
Superfamily PH domain-like 1.97e-36
Family VPS36 N-terminal domain-like 0.00000116
Further Details:      
 
Domain Number 2 Region: 274-381
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 2.72e-29
Family Transcriptional regulator IclR, N-terminal domain 0.096
Further Details:      
 
Domain Number 3 Region: 182-307
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00000000000381
Family Vacuolar sorting protein domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000004534   Gene: ENSAPLG00000004957   Transcript: ENSAPLT00000005150
Sequence length 383
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB742740.1:442228:459608:-1 gene:ENSAPLG00000004957 transcript:ENSAPLT00000005150 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XCWSSELLELGETLVVQQRGVRLYDGEEKVKFESGVLLLSTHRLLWRDQKNHECCIAIPL
SQVVFIEEQAAGIGKSAKIVVHLHPASSNKEPGPFQSSKYSYIKLSFKEHGQIEFYRRFS
EEITQRRWENIPTGQTFQVAKGPQAGRTRAIGIVGIERKLEEKRKETDKNISEAFEDLSK
LMEKAKEMVELSKSIANKIKEKQGDITEDETIRFKSYLLSMGIANPVTRETHGSGTHYHM
QLAKQLAGMLQTPLEERGGIMSLTEVYCLVNRARGLELLSPEDLVNACKMLESLKLPLRL
RIFDSGVMVLELQSHNEEEMVASALETVSEKGSLTADEFAKLVGMSVLLAKERLLLAEKM
GHLCRDDSVEGLRFYPNLFLTQS
Download sequence
Identical sequences U3IBB2
ENSAPLP00000004534

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]