SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000004607 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000004607
Domain Number 1 Region: 24-446
Classification Level Classification E-value
Superfamily Sema domain 9.29e-107
Family Sema domain 0.00025
Further Details:      
 
Domain Number 2 Region: 1287-1416,1593-1779
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 2.94e-50
Family p120GAP domain-like 0.016
Further Details:      
 
Domain Number 3 Region: 781-877
Classification Level Classification E-value
Superfamily E set domains 7.13e-17
Family Other IPT/TIG domains 0.008
Further Details:      
 
Domain Number 4 Region: 874-963
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000504
Family Other IPT/TIG domains 0.023
Further Details:      
 
Domain Number 5 Region: 449-500
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000017
Family Plexin repeat 0.0024
Further Details:      
 
Domain Number 6 Region: 962-1052
Classification Level Classification E-value
Superfamily E set domains 0.0000101
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.053
Further Details:      
 
Weak hits

Sequence:  ENSAPLP00000004607
Domain Number - Region: 1439-1533
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00844
Family Ubiquitin-related 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000004607   Gene: ENSAPLG00000004968   Transcript: ENSAPLT00000005223
Sequence length 1812
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB743204.1:2247370:2324430:-1 gene:ENSAPLG00000004968 transcript:ENSAPLT00000005223 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALWIWTLSILSCFCITLSRNEELNFFQSTTELNHLTVDNETGIVYLGVVNALYQLTEKL
IKINQVETGPRKDNKKCTPPIDENQCKEAVLTDNYNKLLLLDKADKTIVVCGSLFKGICA
IRDLEDISNVKYYVDSSGEKSFVASNDENVSTVGLITSLNNDRVLFVGKGNGPNDNGIII
STRQLYSRDGKDIFEMYTDSAAVKSAYHSSSTQQFVTVFEQQEKQPVNNRTLIARLCKDD
AHYYSYFEMDLGCKDDDGAYDHCHAAYVTSPGDDKVLVALFSKVNKDNGSPKSAMCVFSL
RHINDKMEKNRNDCYTNKNTSMFYKLFAVENPCGSHGLNASKNFPCGSEHLPYLLGSKNG
VVEKPVLQKEGMNLTAVTVTVENGHTVAFLGTSDGKILKVFLSSTATEYSSLTIELNKPI
KNDLVLDKTQENLYVMTTDKVHLLPVQDCFKYSDCEKCMQARDPYCGWCVREGRCTKRAD
CETADKENHWLWSPSGTCVTIISADPRNMSRRAPATVKLTVSPLPALNSDDQLLCTFGDT
THPAQLNEGVISCGPPKVIPPTPEGQDHVSVPLRLTFREKEIFFASHTYPFYDCEEAMNL
YENQPCYSCASNRWNCQWDWKRHICEESSSTEDVIKQNMEEECPQFLNPSPPIIPMEYRT
TVYFEGKHLDYYLGKKFVVGNRQFEFETPVVESADGNFSFMTKEFSYSANETVQLNLSIT
TSKVKIDSKLMVTLYNCSYGRSDCSLCLAAHQDYKCVWCEEDGKPSKCVYDKFCHARPAV
TCPPPEITRIEPKTGPLSGGILLTIMGSNLGIKAEDVNNITVADKECIFKEEFYSVSTRI
VCQVGRMDEPTQGQIEVNINGKLGISPSEVQFTYQEPHPSGIRPESGPQAGGTTLTITGT
NLETGSKKDVRVLVGSQPCNVTDFGDEIVCVTGRNSKVEAVKVTLLYGETVINVPGQFSY
SENPTVTKFLPVNSFSSGGRNITVTGTGFELIQSFSLVVYAERPEAGKASLKRFDGRSVT
RLNETTVIFSSPPILEDPENYNITTIILMDHYQLVVKNESHSFAYVADPTFENFTDGIKK
QVNKLINAKGSNLNKAMTIDEAQAFVGDEPCNIKTLTETDLYCEPPEVQPQPKKRQKRDM
INNLPEFIVKFGLREWILGRVEYDTRVSDIPLNLILPLVLIPMIAIIVISIICYRRKSQQ
AEREYEKIKAQLEGLEESVRDRCKKEFTDLMIEMEDHTSDVNEAGIPVLDYKTYTDRVFF
LPSKDGEKDVMITGNLDIPEARRQTVEQALNQFSNLLNSKSFLINFIHTLENQREFSARA
KVYFASLLTVALHGKLEYYTDIMRTLFLELMEQYVVAKNPKLMLRRSETVVERMLSNWMS
ICLYQYLKDNAGEPLYKLFKAIKHQVEKGPVDAVLKKAKYTLNDTGLLGDDVEYTQLTVN
VYVQDGGTDSTPVKVLNCDTITQVKEKIIDQVYRNLPCSQWPKAESVALEWRPGSTAQIL
SDLDLTSQKDGRWKRINTLMHYNVRDGATLILSKMGISQQPEDNQQDVPGERHALLEDEN
KVWHLVRPVDEIDEGKSKRGSVKEKERTKAITEIYLTRLLSVKGTLQQFVDNFFHSVLNS
NHVVPPAVKYFFDFLDEQAEKHDIKDEDTIHIWKTNSLPLRFWVNILKNPHFIFDVHVHE
VVDASLSVIAQTFMDACTRTEHKLSRDSPSNKLLYAKEISNYKKMVEDYYKGIRQMVPVS
DQDMNTHLAEISRAHTDSLNTLVALHQLYQYTNKYYDEIINALEEDPAAQKMQLAFRLQQ
IAAALENKVTDL
Download sequence
Identical sequences U3IBI5
ENSAPLP00000004607

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]