SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000004657 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000004657
Domain Number 1 Region: 42-413
Classification Level Classification E-value
Superfamily SAICAR synthase-like 1.24e-124
Family Phosphatidylinositol phosphate kinase IIbeta, PIPK IIbeta 0.00000559
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000004657   Gene: ENSAPLG00000005085   Transcript: ENSAPLT00000005275
Sequence length 664
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB743134.1:188458:206237:1 gene:ENSAPLG00000005085 transcript:ENSAPLT00000005275 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ACALLGSHRALSLQGPSLPGQPGQGKKIGHRGVDASGETTYKKTTSSTLKGAIQLGIGYT
VGNLSSKPERDVLMQDFYVVESIFFPSEGSNLTPAHHYADFRFKTYAPVAFRYFRELFGI
RPDDYLYSLCNEPLIELSNPGASGSLFYVTSDDEFIIKTVMHKEAEFLQKLLPGYYMNLN
QNPRTLLPKFYGLYCVQSGGKNIRVVVMNNILPRVVKMHLKFDLKGSTYKRRASKKEKEK
SSPTYKDLDFIQDMPEGLMLDADTFSALVKTLQRDCLVLESFKIMDYSLLLGVHNIDQQE
RERQSEGAHSTSDEKRPVGQKALYSTAMESIQGGAARGESIDTDDTMGGIPAVNGKGERL
LLHVGIIDILQSYRFIKKLEHTWKALVHDGDTVSVHRPSFYAERFFKFMTNTVFRKNSSL
KSSPSKKGRSALLAVKMPGPTAAFSASQLPSEKDETQYDLRAARSYPTLDDEAGRPDLLP
CTPPSFEEATTASIATTLSSTSLSVPERSPSETSEQPRYSRRRTHSSGQDGRSHEEVRVE
EELQQISVELEPKCDVEIVAPEEDDKEEAASSACAIGTSTATIEVETASQASEPASQASD
EDDVPVTDIYFFTDGRYWIYSPRQRRLRTTSLSSGTPTDERSWVYSPLHYSAQLHSVSDE
ESDT
Download sequence
Identical sequences U3IBN5
ENSAPLP00000004657

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]