SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000004696 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000004696
Domain Number 1 Region: 1-79
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.03e-23
Family Heat-shock transcription factor 0.00031
Further Details:      
 
Weak hits

Sequence:  ENSAPLP00000004696
Domain Number - Region: 67-147
Classification Level Classification E-value
Superfamily tRNA-binding arm 0.0628
Family Seryl-tRNA synthetase (SerRS) 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000004696   Gene: ENSAPLG00000005126   Transcript: ENSAPLT00000005314
Sequence length 442
Comment pep:novel scaffold:BGI_duck_1.0:KB743210.1:301984:314086:-1 gene:ENSAPLG00000005126 transcript:ENSAPLT00000005314 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NGENFCILDEQRFAKELLPKYFKHNNISSFIRQLNMYGFRKVIALENGMITAEKSSVIEF
QHAFFKQGKAHLLENIKRKVSAVRTEDLKVCAEDLHKVLSEVQEMREQQNNMDVRLANMK
RENKALWKEVAVLRQKHSQQQKLLSKILQFILSLMRGNYIVGVKRKRSLTDAAGASPSKY
SRQYVRIPVESGQAVSLSREGDTGLDRMLYSLIIRDITDTLENATNGLLAVAHTSGRASK
LKKNKNQKPIRIKETQTALDPGLPICQVSQPNELNCVEPIPPVHINDVSKSGEIGNVAVE
LHAAQANAPEDPASVIDSILNENNSGNQSDPLLDREEIQDFLNCIDASLEELQAMLSGKQ
YNFGSEAFSDLSILFYSLSILLQIANLADSTEDLGASERETAGSKGGQEGTAVTIPNSSK
NMQLIQYRANPLLSLFEELPSS
Download sequence
Identical sequences U3IBS4
ENSAPLP00000004696

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]