SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000004702 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000004702
Domain Number 1 Region: 1013-1082
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.000000000384
Family SAM (sterile alpha motif) domain 0.027
Further Details:      
 
Domain Number 2 Region: 893-970
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.0000000037
Family SAM (sterile alpha motif) domain 0.028
Further Details:      
 
Domain Number 3 Region: 1095-1137
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.0000489
Family SAM (sterile alpha motif) domain 0.039
Further Details:      
 
Weak hits

Sequence:  ENSAPLP00000004702
Domain Number - Region: 249-499
Classification Level Classification E-value
Superfamily Tropomyosin 0.00719
Family Tropomyosin 0.0014
Further Details:      
 
Domain Number - Region: 641-669
Classification Level Classification E-value
Superfamily Tropomyosin 0.0589
Family Tropomyosin 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000004702   Gene: ENSAPLG00000005058   Transcript: ENSAPLT00000005321
Sequence length 1245
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB743402.1:1141503:1196755:1 gene:ENSAPLG00000005058 transcript:ENSAPLT00000005321 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMCEVMPTISEAEIPSGGNGGHGSGSPLQSDADSHFEQLMVSMLEERDRLLETLRETQET
LTLTQGKLHEVGHERDSLQRQLNTALPQEFAALTKELNVCREQLLEREEEIAELKAERNN
TRLLLEHLECLVSRHERSLRMTVVKRQAQSPAGVSSEVEVLKALKSLFEHHKALDEKVRE
RLRVALERCSLLEEELGTTHKELMILKEQNNQKKTLPDGMLDINHEQENTPTTNGKRSSD
GSLCHDENLAKVIELQDIIDKQNKEQTQMKERLTSLSSRVAELEEDLDTARKDLIKSEEM
NTKLQRDVRETMAQKEDMEERITTLEKRYLAAQREATSVHDLNDKLENEIATKDSMHRQS
EDKNRQLQERLELAEQKLQQTLRKAETLPEVEAELAQRVAALSKAEERHGNIEERLRQME
AQLEEKNQELQRARQREKMNEEHNKRLSETVDKLLSESNERLQLHLKERMAALEDKNSLI
REIENAKKQIEELQHEKDQLVINVEALRAENDQVRLRATSLHHSRNHLGFSRPDFRYPMT
SSVADSHTDSYGTSSVLRRPQKGRLAALRDEPSKVKTLNEQDWERAQQASVLANVAQAFE
SDVDVSDGEDDRETIFSSVDLLSPSGQADAQTLAMMLQEQLDAINKEIRLIQEEKENTEQ
RAEEIESRVGSGSLDAHGRFRSMSSIPPPYASGSLAGSSPPGSGRSTPRRIPHSPAREVD
RLGIMTLPSDLRKHRRKSPASREEVRDDKTTIKCETSPPSSPRSLRLDRVQKGALHTVSH
EDIRDVRNSTGSQDGQASNPSSSNSSQDSLHKAPKKKGIKSSIGRLFGKKEKGRPGQTNK
ETLGQVGMAEADSSSQDALGLSKLGGQAEKNRKMQKKYFSESGHELLEEARRQGLPFAQW
DGPTVVVWLELWVGMPAWYVAACRANVKSGAIMSALSDTEIQREIGISNPLHRLKLRLAI
QEIMSLTSPSAPPTSRTTTGNVWVTHEEMENLTATQQTEDEEGSWAQTLAYGDMNHEWIG
NEWLPSLGLPQYRSYFMECLVDARMLDHLTKKDLRGQLKMVDSFHRNSFQCGIMCLRRLN
YDRKELERKREESQAEIKDVLVWSNERMIRWVLSIGLKEYANNLVESGVHGALVALDETF
DYNALALLLQIPTQNTQARAVLEREFNNLLVMGTDRRLDEDDDKSFRRAPSWRKKFRPKD
IRGLAAGSAETLPANFRVTTSMSSPSMQPKKMQIDGSVSGTQRLD
Download sequence
Identical sequences U3IBT0
ENSAPLP00000004702

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]