SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000004711 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000004711
Domain Number 1 Region: 2166-2459
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 3.25e-98
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.000000000269
Further Details:      
 
Domain Number 2 Region: 673-781
Classification Level Classification E-value
Superfamily Second domain of FERM 7.85e-33
Family Second domain of FERM 0.00029
Further Details:      
 
Domain Number 3 Region: 783-889
Classification Level Classification E-value
Superfamily PH domain-like 1.2e-26
Family Third domain of FERM 0.0021
Further Details:      
 
Domain Number 4 Region: 1350-1443
Classification Level Classification E-value
Superfamily PDZ domain-like 1.45e-26
Family PDZ domain 0.0000524
Further Details:      
 
Domain Number 5 Region: 1772-1859
Classification Level Classification E-value
Superfamily PDZ domain-like 6.18e-22
Family PDZ domain 0.013
Further Details:      
 
Domain Number 6 Region: 1484-1588
Classification Level Classification E-value
Superfamily PDZ domain-like 4.07e-21
Family PDZ domain 0.039
Further Details:      
 
Domain Number 7 Region: 580-673
Classification Level Classification E-value
Superfamily Ubiquitin-like 6.94e-18
Family First domain of FERM 0.016
Further Details:      
 
Domain Number 8 Region: 1863-1957
Classification Level Classification E-value
Superfamily PDZ domain-like 3.81e-17
Family PDZ domain 0.047
Further Details:      
 
Domain Number 9 Region: 1092-1154
Classification Level Classification E-value
Superfamily PDZ domain-like 0.000000000000186
Family PDZ domain 0.02
Further Details:      
 
Weak hits

Sequence:  ENSAPLP00000004711
Domain Number - Region: 2-154
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.000236
Family Protein kinases, catalytic subunit 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000004711   Gene: ENSAPLG00000005052   Transcript: ENSAPLT00000005330
Sequence length 2474
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB742619.1:3826240:3911367:-1 gene:ENSAPLG00000005052 transcript:ENSAPLT00000005330 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHVSLAEALEVRGGPLQEEEIWAILNQSAESLQELFRKDNTADPTALGFIISPWSLLLLP
SGSVSFTDDNVSQQDLRAFTAPEVLQNQSLSSLSDVEKVHIYSLGMTLFWGADHEVPQSQ
PIKLGDHLNSILLGMCEDVIYARVSVRTVLDACSAHIRNSNCAPSFSYVKQLVRLVLGSL
SGMDQLACNGDKKLQPDRSQAIRERLRGKGLPTGKALVVDADDGHKTHFSQQTMLNKGLS
KSMGFLSIRGTQGEEEFFQGISSDYNSGQEDAFCPHRCKTNEFEKKGHLHTDAAPRRKVW
ASSTDLLCTTDKATERDHAGDSHRHGHQCETFTVRTSTTTRNKEARYSDGSIALDVFGPQ
KLDQTRHVPETSTSAAISSAFDRIRERQKKLQLLREAMNVEEPLRRYKSYHSDVYSTSSE
SPSVISSEPDFRQGLLVRRNEGFKRDDTNGGLPGADDISTSSQANSQRARKQHETSFEGN
LISQEVMLKRQEEEMMQLQARMALRQSRPNLYPGDAIRSSMLDITRDPLREIALETAMTQ
RKLRNFFGPEFVKMTIEPFISLDLPKSILTKKGKNDDTRRKVNVMLLSGQKLELTCDTKT
ICKDVFDMVVAHIGLVEHHLFGLATLRDNEFFFVDPDIKLSKVAPEGWKEEPKKKNKPPV
NFTLFFRIKFFVDDVSLIQHTLTCHQYYLQLRKDILEDRMHCDDETALLLASLALQAEYG
DYQAEVHGMSYFRLEHYVPARVMEKLDTSYIKEELPKLHSTYVGASEKETELEFLKLCQR
LTEYGIHLHHVLPEKRSQTGILLGVCSKGVVIFEVHNGARTPVLRFPWRETKKISFSKKK
ITLQNTSDGIKHAFQTDNSKTCQYLLHLCSSQHKFQLQMRTRQSNQDTQDIERASFRSLN
LHAESVKGFNMGRAISTGSLASSTLNRLAVRPLSVQAEILKRLSCSELSLFQPLPGSSKD
KNEKTSWEDRPRVMSKSFHDLSQSHISVYPPKKNIIAALDSSSQKIEDIMGRVFQQIPKF
DTGSAAGALKLSNSKSHAGLSRSPERKKNESDSSSIEDTGQAYVVGVSMNSSGNLPTSTP
LKESTDSLQTTQSRVSSPEREITLVNLKKDEKMGLGFQIVGGEKTGKLDLGIFIHSVTPG
GPADLEGSLKPGEYCKLGELNNMKIKDISITIKISILLMAKEKVERVKKKIRERFGRLIS
TSLVILFKMSGENHSCDFQELSNITSWACLSTLADSVENTFAVLWFYPENFIAASHARAE
SLLLHLAESTSDGDSSVSLFHNQLTLTVKAQLLKVRHVSALKLCSVKGVKAMSLMSQTDG
PFPMWTPFIKESSSANTAHKTNSKKVTAALLKPGDIFEVELAKKDNGLGISVTGGVNTSI
RHGGIYVKAIIPKGAAEADGRIEKGDRVLSVNGISLEGATHKQAVETLRNTGQVVHLLLE
KGQLSAAKVHAPVTPQCTPPNQVGQCEPQGKPAIKATNAKDYSFVTAENTFEVKLLKNSS
GLGFSFCREDNLTPEQLGSTIVRVKKLFPGQPAAESGQIEIGDVILKVNGASLKGLSQQE
VISALRGTSPEVSLLLCRPPPGILPDIDPSLLTPIHSPHQVFPDVSREVSGPSTGEQADS
SDENETIDPSKKRLKSPSRRDSYSDSSRSGDEEVMDSAAQVGSGWSSALYQPSGEAVPQA
HSQYEARSGQEEAVRTILCSVHETSSKSELEDDSTVPLDLPLIPTCRTVPDVTTSVLMNN
CFATPASELTPHLGGMASLLSQLEKNAEEYEPEVELQVTMTKSEKGSLGFTVTKGNDNVG
CYIHDIVQDPAKSDGRLRPGDRLIKVNDIDVTNMSHTDAVNFLRAAPRTVRLVLGRVLEL
PKMPVLPHLLPDITLTCHKEELGLVLSGGHDSLYQVVYISDILPRSVAAREESLHALDII
HYINGVSTQGMSLKEAKRSLETSLPKVVLKATRDGHPVLPKSKSPNSSNSWSKKSNDGLS
CIGSQQAILTFCFSLSDVNGNGILGTSHANTENNTHHTKGLMNLTGFSETEVPDDEYYDE
DDHNEVVQYLLDVVDEEAQNLLNRNNATSHSDSPATVEMNGKLTEDKSEDTDCDGSSLPE
DFSEPTHLNGCEDHCEEKAVPERSPPQPPLSQADEDEITWGSDELPIESINQERVNKDFP
LVTNEEISSLPTVNVLPGGKYSGAKLKSVIRMLRGLLEQGVPSKEIENLQELKPLDQCLI
GQAKENRKKNRYKNILPYDTTRVPLGTEGGYINASFIRMPVGNEEFIYIACQGPLPTTVA
DFWQMVWEQKCTVIAMMTQEVEGEKIKCQRYWPDVLNKTTMITDRLRLALVRFQQLKGFI
IRVLELEEIQTGEVRHISHLNFIAWPDHDTPSQPDDLLTFISYMRHVYKSGPIVTHCSAG
IGRSGTLICIDVVLGLISRDLDFDISDLVRTMRLQRHGMVQTEDQYIFCYQVVLYVLNHL
QQEEQRGRKKSLLK
Download sequence
Identical sequences U3IBT9
ENSAPLP00000004711

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]