SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000004713 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000004713
Domain Number 1 Region: 84-142
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.000000000000411
Family SAM (sterile alpha motif) domain 0.00089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000004713   Gene: ENSAPLG00000005142   Transcript: ENSAPLT00000005332
Sequence length 467
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB744769.1:226995:296664:1 gene:ENSAPLG00000005142 transcript:ENSAPLT00000005332 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LSGQTHHSPLKRSVSLTPPMNVPNQPLGHGWMSHEDLRARGPQCIPSDHAPLSPQSSVAS
SGSGGSEHLEDQPSARNTFQEEGSGMKDVPAWLKSLRLHKYAALFSQMTYEEMMALTECQ
LEAQNVTKGARHKIVISIQKLKERQNLLKSLERDILEGGNLRVPLQELHQMILTPIKAYC
SQTSSPEEHGRDADSHHPPSLLGSDSQGSDCKDSAAGGMQQHHLPGCEGESGGAPLPEGD
LPGQFTRVMGKAVCTQLLVSRPDEENISSYLQLIDKCLIHEAFTEIQKKRLLSWKQQVQK
LFRSFPRKSLLELSGYRQQRSSGSAQTRSELSSGPFCSSHQQNNPKKNECQPATSPPPAR
GLLGPSGLLGTPQRSPAASPAILKQGRQNLWFANPGGSNSMPSRSHSSVQRTRSLPVHTS
PQTMLMFQQPEFQVPVTEPDINNRLESLCLSMTEHALSDGVDRTSTI
Download sequence
Identical sequences U3IBU1
ENSAPLP00000004713

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]