SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000004795 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000004795
Domain Number 1 Region: 6-123
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.95e-32
Family Ankyrin repeat 0.00094
Further Details:      
 
Domain Number 2 Region: 395-455
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.00000000134
Family SAM (sterile alpha motif) domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000004795   Gene: ENSAPLG00000005245   Transcript: ENSAPLT00000005415
Sequence length 469
Comment pep:novel scaffold:BGI_duck_1.0:KB742575.1:401890:409262:-1 gene:ENSAPLG00000005245 transcript:ENSAPLT00000005415 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNDQYHRAARDGYLDLLKEATKKDLNSPDEDGMTPTLWAAYHGNLDALRLIVSRGGDPDK
CDIWGNTPLHLAAANGHLNCLSFLISFGANIWCLDNDYHTPLDMAAMKGHMECVRYLDSI
AAKQSSLNPKLVSKLKDKAFRDAERRIKDCVKLQKKHHERMEKRYRKEMSDNSDTMSFSS
YSSSTLSKKFQHMSMVTSLPYSQATIHGTAKGKTKIQKKLEKKKQVDGTFKIYEDGRKSV
RSLSGLQLGNDVMFVKQGTYASPKEWTRRNIRDMFLTDEDTVSRAISDPGLHMDSAHSEV
STDSGHDSLFNRPGLGTMVFRRNYVSSGLFGIGREDAGMPGEGDTDGLGVKLRSRLQRSP
SLNDSIGSANSLQERNAEDLPWDEVELGLDDDDEPDTSPLETFLASLHMFEFISILKKEK
IDLEALMLCSDNDLKSINIPLGPRKKIVDAIQRRRQTLERPDVIVDTEL
Download sequence
Identical sequences R0M2L5
ENSAPLP00000004795 XP_005012045.1.99704 XP_005012046.1.99704 XP_013034334.1.65836

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]