SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000004938 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000004938
Domain Number 1 Region: 253-316
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.000000000816
Family C-terminal fragment of elongation factor SelB 0.072
Further Details:      
 
Weak hits

Sequence:  ENSAPLP00000004938
Domain Number - Region: 61-176
Classification Level Classification E-value
Superfamily TPR-like 0.00683
Family Tetratricopeptide repeat (TPR) 0.019
Further Details:      
 
Domain Number - Region: 156-242
Classification Level Classification E-value
Superfamily Apolipoprotein A-I 0.0929
Family Apolipoprotein A-I 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000004938   Gene: ENSAPLG00000005358   Transcript: ENSAPLT00000005562
Sequence length 389
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB744807.1:24690:27359:-1 gene:ENSAPLG00000005358 transcript:ENSAPLT00000005562 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XRPRMGKAASAPLLPEVETYLQLLLVIFLMNSKRYPEGQPLGSSAFHLLRFPHRRALDLV
VAKCYYYHSRIYEFLNKLDVVRSFLHARLRTATLRHDADGQATLLNLLLRNYLHYNLYDQ
AEKLVSKSVFPEQANNNEWARYLYYTAGRIKAIQLEYSEARRTMTNALRKAPQHTAVGFK
QTVKRLLIVVELLLGEIPDRLQFRQPSLKRSLMPYFLLTQAVRTGNLAKFNQVLDQFGDK
FQADGTYTLIIRLRHNVIKTGVRMISLSYSRISLADIAQKLQLDSPEDAEFIVAKAIRDG
VIEASINHEKGYVQSKEMIDIYSTREPQLAFHQRISFCLDIHNMSVKAMRFPPKSYNKDL
ESAEERREREQQDLEFAKEMAEDDDDGFP
Download sequence
Identical sequences U3ICG6
ENSAPLP00000004938

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]