SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000004982 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000004982
Domain Number 1 Region: 3-93
Classification Level Classification E-value
Superfamily Ubiquitin-like 8.38e-29
Family Ubiquitin-related 0.0000659
Further Details:      
 
Domain Number 2 Region: 100-154
Classification Level Classification E-value
Superfamily Zn-binding ribosomal proteins 5.13e-21
Family Ribosomal protein S27a 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000004982   Gene: ENSAPLG00000005406   Transcript: ENSAPLT00000005606
Sequence length 156
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB743040.1:2003785:2005852:-1 gene:ENSAPLG00000005406 transcript:ENSAPLT00000005606 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LLLYLTCASGQNLEEKVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
IQKESTLHLVLRLRGGAKKRKKKSYTTPKKNKHKRKKVKLAVLKYYKVDENGKISRLRRE
CPSEECGAGVFMASHFDRHYCGKCCLTYCFNKPEDK
Download sequence
Identical sequences U3ICL0
ENSAPLP00000004982

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]