SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000004992 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000004992
Domain Number 1 Region: 917-986
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.000000000539
Family SAM (sterile alpha motif) domain 0.026
Further Details:      
 
Domain Number 2 Region: 792-868
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.000000000686
Family SAM (sterile alpha motif) domain 0.026
Further Details:      
 
Domain Number 3 Region: 997-1074
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.000000157
Family SAM (sterile alpha motif) domain 0.051
Further Details:      
 
Weak hits

Sequence:  ENSAPLP00000004992
Domain Number - Region: 174-428
Classification Level Classification E-value
Superfamily Tropomyosin 0.00497
Family Tropomyosin 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000004992   Gene: ENSAPLG00000005353   Transcript: ENSAPLT00000005617
Sequence length 1137
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB742717.1:367335:490126:1 gene:ENSAPLG00000005353 transcript:ENSAPLT00000005617 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EFAALTKELNACREQLLEKEEEISELKAERNNTRLLLEHLECLVSRHERSLRMTVVKRQA
QSPSGVSSEVEVLKALKSLFEHHKALDEKVRERLRVSLERVSALEEELAAANQEIVALRE
QNAHIQRKIAAGEGPAESEHIEGMEPGQKVHEKRLSNGSIDSNDEASQVVELQELLEKQN
YEMAQMKERLAALSSRVGEVEQEAETARKELIKTEEMNTKYQRDIREAMAQKEDMEERIT
TLEKRYLSAQRESTSIHDMNDKLENELANKEAILRQLEDKNRQLQERLELAEQKLQQTMR
KAETLPEVEAELAQRIAALTKAEERHGNIEERMRHLEAQLEEKNQELQRARQREKMNEEH
NKRLSDTVDRLLTESNERLQLHLKERMAALEEKNVLIQESESFRKNLEESLHDKERLAEE
IEKLRSELDQMKLRAGSLIEPTLSRPHLDSSTELRYSVGSLVDSQSDYRSTKVIRRPRRG
RMGVRRDEPKVKSLGDHEWNRTQQIGVLSSHPFESDTEMSDIDDDDRETLFSSMDLLSPS
GHSDAQTLAMMLQEQLDAINKEIRRLIQEEKESTELRAEEIENRVASVSLEGLNLARVHQ
GTSITGSVTASSLASSSPPSGHSTPKLTPRSPAREMDRMGVMTLPSDLRKHRRKIAVVEE
DGREDKATIKCETSPPPTPRAIRMTHTLPSSYHNDARSSLPASLEPESIGLGSVNSSQDS
LHKAPKKKGIKSSIGRLFGKKEKARLGQLRGYMETEAAAQESLGLGKLGTQAEKDRRLKK
KHELLEEARRKGLPFAQWDGPTVVAWLELWLGMPAWYVAACRANVKSGAIMSALSDTEIQ
REIGISNPLHRLKLRLAIQEMVSLTSPSAPPTSRTPSGNVWVTHEEMENLAAPAKTKESE
EGSWAQSKVIETLAYGDMNHEWIGNEWLPSLGLPQYRSYFMECLVDARMLDHLTKKDLRV
HLKMVDSFHRTSLQYGIMCLKRLNYDRKELEKRREMSQHEIKDVLVWSNDRVIRWIQAIG
LREYANNILESGVHGSLIALDENFDYSSLALLLQIPTQNTQARQILEREYNNLLALGTER
RLEESDDKNFRRGPSWRRQFPPREVHGISMMPGSSETLPAGFRLTTTSGQSRKMATD
Download sequence
Identical sequences U3ICM0
ENSAPLP00000004992

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]