SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000005083 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000005083
Domain Number 1 Region: 5-138
Classification Level Classification E-value
Superfamily L domain-like 3.17e-23
Family Ngr ectodomain-like 0.034
Further Details:      
 
Domain Number 2 Region: 493-553
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.0000000000185
Family SAM (sterile alpha motif) domain 0.0093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000005083   Gene: ENSAPLG00000005497   Transcript: ENSAPLT00000005710
Sequence length 559
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB744204.1:979361:999127:1 gene:ENSAPLG00000005497 transcript:ENSAPLT00000005710 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NYLLFQVLDLHDNQLASLPVDIGQLTSLQVLNLERNLLKCLPQSIGDLAQLQILNVKGNK
LKELPATVSGLRSLRTLDISENLLQELPRVLAHIRTLKMLTLDASSMTYPSADICSAGTE
SIQQFLCKECGIAYYPPSQDALPALESDGGETSVDGVDRTVQKYLEEENKWQNKFLDYEK
RKEKKMQEKLEFERRLNMGQREHALLVQQISSQKDEILQTVREDQMRLEKGLTKHQRHLE
EERLKLLQQLKQAEQGIASRIQKLIEDNQRQKQSSDILKSLENERIRMEQLMAITQEETE
QLRRREVASAMQQMLAESYKNKLIQMTYESRRQDLVNQACSSLAEMDQKFQQILAWQQLD
QNKAVSQILQQSEMQKAAFEALQLKKDLMHRQIRKQIKLIETELLQLTQLELKRQELDTE
TLQGVIMEQRQALGYLLQQLLKEKKQREEELQQILLEMEAKSETKQENYWLIQYQRLLNQ
KPLSLKLQEEGLEKQLVNLLIELSAEQYVPVFAHHRISLQVLSTMTASDLEKMGVTEAGL
QRAILRRAQEILAVAKTIP
Download sequence
Identical sequences U3ICW1
ENSAPLP00000005083

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]