SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000005126 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000005126
Domain Number 1 Region: 38-114
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 3.99e-24
Family RPO3F domain-like 0.0000321
Further Details:      
 
Domain Number 2 Region: 1-36
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00000000925
Family RPO3F domain-like 0.00092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000005126   Gene: ENSAPLG00000005533   Transcript: ENSAPLT00000005754
Sequence length 275
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB742580.1:2957257:2964750:-1 gene:ENSAPLG00000005533 transcript:ENSAPLT00000005754 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPHMEAQQRAMAINRLLSMGQLDLLRSNAGLLYRIKESQNASKMKGSDNQEKLVYQIIED
AGNKGIWSRDIRYKSNLPLTEINKILKNLESKKLIKAVKSVAASKKKVYMLYNLQPDRSV
TGGAWYSDQDFESEFVEVLNQQCFKFLQSKAEAARESKQNPMIQRNSSFASSHEVWKYIC
ELGISKVELSMEDIETILNTLIYDGKVEMTIIAAKEGTVGSVDGQMKLYRAVSPLLQPTG
LVRTPCGLCPVFDDCHEGGEISPSNCIYMTEWLEY
Download sequence
Identical sequences U3ID04
XP_012948086.1.99704 ENSAPLP00000005126

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]