SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000005140 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000005140
Domain Number 1 Region: 14-125
Classification Level Classification E-value
Superfamily Ubiquitin-like 6.46e-39
Family GABARAP-like 0.00000279
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000005140   Gene: ENSAPLG00000005584   Transcript: ENSAPLT00000005768
Sequence length 125
Comment pep:novel scaffold:BGI_duck_1.0:KB742958.1:113036:119999:1 gene:ENSAPLG00000005584 transcript:ENSAPLT00000005768 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EMFRRRPGKPQRSEKNCREQRVEDVRLIREQHPTKIPVIIERYKGEKQLPVLDKTKFLVP
DHVNMSELIKIIRRRLQLNSNQAFFLLVNGHSMVSVSTPISEVYESEKDEDGFLYMVYAS
QETFG
Download sequence
Identical sequences U3ID18
ENSAPLP00000005140

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]