SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000005170 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000005170
Domain Number 1 Region: 126-276
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 2.43e-33
Family p120GAP domain-like 0.000000152
Further Details:      
 
Domain Number 2 Region: 4-140
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.2e-17
Family Synaptotagmin-like (S variant) 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000005170   Gene: ENSAPLG00000005611   Transcript: ENSAPLT00000005798
Sequence length 276
Comment pep:novel scaffold:BGI_duck_1.0:KB746089.1:483:5349:-1 gene:ENSAPLG00000005611 transcript:ENSAPLT00000005798 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VSSLILHVEEAHTLPVKHFTNPYCNIYLNSVQVAKTHIREGQNPVWSEEFVFDDLSSDIN
RFEISLSNKTKKSKDPDILFMRCQLSRLQKGHATDEWFQLSSHIPLKGIEPGSLRVRARY
SMEKIMPEEEYSEFKELILQKELHVVYALSHVCGQDRTLLAGILLKIFLHEKLESLLLRT
LNDKEISMEDEATTLFRATTLASTLMEQYMKATATRFVHHALKDCILKIMESKQSCELNP
SKLEKNEDINTNLAHLLSILSELVEKIFMAAEILPP
Download sequence
Identical sequences U3ID48
ENSAPLP00000005170

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]