SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000005173 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000005173
Domain Number 1 Region: 215-356
Classification Level Classification E-value
Superfamily E2F-DP heterodimerization region 7.85e-57
Family DP dimerization segment 0.000000682
Further Details:      
 
Domain Number 2 Region: 130-209
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 6.26e-24
Family Cell cycle transcription factor e2f-dp 0.0000151
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000005173   Gene: ENSAPLG00000005603   Transcript: ENSAPLT00000005801
Sequence length 446
Comment pep:novel scaffold:BGI_duck_1.0:KB742505.1:820078:850431:1 gene:ENSAPLG00000005603 transcript:ENSAPLT00000005801 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KCFVQVGVTSTNGDLKGFIDQNQSPTKGNISIITLPVSSTNSPTKILPKTLGPINVNVGP
QMLISTSQRLTNSGSVLIGSPYSPAPTMVTQTHITEATGWVPGDRKRTREFIESDFSESK
RSKKGDKNGKGLRHFSMKVCEKVQRKGTTSYNEVADELVSEFTNSNSHLATDSAYDQKNI
RRRVYDALNVLMAMNIISKEKKEIRWIGLPTNSAQECQNLEIEKQKRIERIKEKRAQLQE
LLLQQIAFKNLVQRNQQNEQQNQGPPALNSTIQLPFLIVNTSKRTVIDCSISSDKFEYLF
NFDNTFEIHDDSEVLKRMGMSFGLEAGKCSAEDLRTAKSLVPKALEGYITDMSAGFSWMN
QGLLSNSAQGISHLEVAGGTSDSKSSENPGLCLDAEVALATGQLLAPSSQQSSSAASRYS
ESRGETPCSFNDEDEEDEDDDSSSPE
Download sequence
Identical sequences R0M0S4
ENSAPLP00000005173

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]