SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000005241 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000005241
Domain Number 1 Region: 1476-1514,1559-1758,1786-1889
Classification Level Classification E-value
Superfamily Cysteine proteinases 4.51e-83
Family Ubiquitin carboxyl-terminal hydrolase, UCH 0.00012
Further Details:      
 
Domain Number 2 Region: 822-917
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000000000253
Family Ubiquitin-related 0.017
Further Details:      
 
Weak hits

Sequence:  ENSAPLP00000005241
Domain Number - Region: 174-283,377-515,563-584
Classification Level Classification E-value
Superfamily ARM repeat 0.00138
Family B56-like 0.089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000005241   Gene: ENSAPLG00000005515   Transcript: ENSAPLT00000005871
Sequence length 2341
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB743201.1:314546:371126:-1 gene:ENSAPLG00000005515 transcript:ENSAPLT00000005871 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FPTTNLYELESRVLTDHWSIPYKREESLGKCLIASTYLARKGLSDSDENCKRFMDRCMPE
AFKKLLTSSAVHKWGTEIHEGIYNMLMLLVDLVAERVKQDPIPVGLLGVLTMAFNPDNEY
HFKNRMKVCQRNWAEVFGEGNMHAVSPISTFQKEPHGWLVDLVNRFAELGGFSAIQSKLN
SEDIELGAISALVQPFGVCAEYLNSSVVQPMLDPVIHKMIKYVQNVEEKDLKDKFRFQQR
LVSIPELLSGIKLLCMRFQPDLVTAVDDLRLDILLRMLKSPHFSAKMNSLKEVGLLHVGV
FVCVHTHVRGWVKNAIDTDRLLNWLVENSVLSIALEGNIDQAQYCDRIKGIIELLGSKLS
LDELTKIWRIQSGQSSTVIENIHTIIAAAAVKFSSDQLNHLFVLIQKSWETESDRVRQKL
LSLIGRIGREARVETTTGKVLEVLWELAHLPTLPCSLIQQALEEHLTILSDAYAVKEAIK
RSYIIKCIEDIKRKFVWVVPALRQLHEITRSFIKQTYQKQDKTISYSLYLRKDLEGSLQH
QHMLKMVLPEGFGYLEGVQLTLKKHFSIKEQTVECMNYYSFVIYLEAHLKFLAFFLQEAT
LYLGWNRAREIWECLVTGQDVCELDREMCFEWFTKGQHDLESDVQQQLFKEKILKLESYE
ITMNGMKSFSLFKTFFENVNLCDHRLKRQGTQLSVEKLELIGMDFIWKIAMESPDEEIAN
EAIQLIINYSYINLTPRLKKDSVSLHKKFIADCYTRLELCILSQCNLSSKKMLTKPVSTK
LVIIERLLLLAERYVITIEDLYSVPRTILPHGASFHGHILTLNVTYESTKDTFTIEAHSN
ETVGSVRWKIAKMLNSPVDNIQIFANDSLLTVNKDQKLLHQLGFSDEQVLTVKTSGSGTP
SGSSADSSTTSSNSSGVFSSSYAMEQEKSLPGVVMALVCNVFDMLYQLANLEEPRITLRV
RKLLLLIPTDPAIQEALDQLDSLGRKSSKSPSLSSKHQHQPSASSILFLKKVLSSKLMPT
ADDEMARNCAKSFCENFLRAGGLSLVVNVMQRDSIPSEVDYETRQGVYSICLQLARNRTQ
SISYSLAMNIQKQCLPYWDGVEALSSRPFRNVSRQGSRQMSICGTPEKSSYRQLSVSDRS
SIRVEEIIPAARVAIQVMACFMRLSWAAAAGRLDLVGSRSEGEPTALHAGICVRQQSVST
KDALIAGEALSLLVTCLQLRSQQLGSFYNLPCVADFIIDILLGSPSAEIRRVACDQLYTL
MPSCLFGHQPASCILFLKMLFSHIVGKTRQSVRPSVGITEMKNYNLVASEMEQLKISPAA
MLEDEITWLDNFEPNRTAESETSEADNILLAGHLRLIKTLLSLCGAEKEMVADVDYFVTG
SSLIKPLLDDFLFRASRIILNSHSPAGSAAISQQDFHPKCSTADSRLAAYEVLVMLADSS
PSNLQLITKELLSMHHQCDPALTKEFDYLPPVDSRSISGFVGLKNGGATCYMNAVFQQLY
MQPGQVIGSVSCKVLFSELTVTLDEDRQNTYTKNIDTQMITFNLSCCVMKTALLSIDDDT
DNPDDNVFYQVQSLFGHLMESKLQYYVPENFWKIFKMWNKELYVREQQDAYEFFTSLIDQ
MDEYLKKIGRDQIFKNTFQGIFSDQKICKDCPHRYEREEAFMALNLGVTSCQSLEISLDQ
FVRGEVLEGSNAYYCEKCKEKRTTVKRTCIKVLPSLLVIHLMRFGFDWESGRSIKYDEQI
RFPWMLNMEPYTVSGMARQDSSSEVGDNGRNADQGSGGSPRKKVAPTENYELVGVIVHSG
QAHAGHYYSFIKDRSYRGCGKGKWYKFNDTVVEEFELTDETLEYECFGGEYRPKVYDQSN
PYPDVRRRYWNAYMLFYQRVSDQNSPVLPKKSRVSVVRQEGILLLQKIFLQMVRDENLKF
MKNRDVYSSDYFSFVLSLASLNATKVKHPYYPCMAKVSLQLAVQFLFQTYLRTKKKLRAD
TEEWIATIDALLSKSIDALNWFKVNYNMFFSLTIKIRTFLLECSVREVRVAVATVLEKTL
DSALLYQEKNKLILCPYPVSVVGKPSRKYFELKSLHQLLEVLLALLDKDVPENCKNCAQY
FLLFNNFVQKSLNVGDLFLDFFFLVGWSLFPPKHINGLGYFLSYTQAREFGYLHNTVALL
VLHSDVSSQRNASVRRNTIASNLRHCITTSGPLLTLHGEVEALLFLSETTYSSKSLSFKS
VTIFVIEMVVYCCFCNERFSFTVLHFIKTQLETAPPHELKNIFQLLHEILVIEDPLQVER
IKFAFETENGLIALMHHSNHVDSSRCYQCVKFLVTLAQKCPTAKDYFKENSHHWSWAVQW
L
Download sequence
Identical sequences U3IDB9
ENSAPLP00000005241

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]