SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000005271 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000005271
Domain Number 1 Region: 18-191
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.28e-59
Family G proteins 0.0000000619
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000005271   Gene: ENSAPLG00000005718   Transcript: ENSAPLT00000005901
Sequence length 212
Comment pep:novel scaffold:BGI_duck_1.0:KB742983.1:98475:220273:-1 gene:ENSAPLG00000005718 transcript:ENSAPLT00000005901 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASAQDSRYGQKDTSDQNFDYMFKLLIIGNSSVGKTSFLFRYADDSFTSAFVSTVGIDFK
VKTVFKNEKRIKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESFNAVQDWSTQI
KTYSWDNAQVILVGNKCDMEDERVIFTERGKHLAEQLGFEFFEASAKDNINVKQTFERLV
DIICDKMSESLETDPTIAAGKQNTRLKDTPPP
Download sequence
Identical sequences R0JXA4
ENSAPLP00000005271

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]