SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000005320 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000005320
Domain Number 1 Region: 841-1041
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 2.55e-38
Family BCR-homology GTPase activation domain (BH-domain) 0.0011
Further Details:      
 
Domain Number 2 Region: 38-71
Classification Level Classification E-value
Superfamily WW domain 0.000000252
Family WW domain 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000005320   Gene: ENSAPLG00000005761   Transcript: ENSAPLT00000005950
Sequence length 1046
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB743775.1:1808:21887:-1 gene:ENSAPLG00000005761 transcript:ENSAPLT00000005950 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RLEWVEIIEPRTRERMYANLITGECVWDPPAGVRIKRTNENQWWELFDPNTSRFYYYNAT
TQRTVWHRPQNCDIIPLAKLQTLKQNTESPRASTENSPGRSSNVSREGSTSSSLEQELEG
GEKVPEQTRSGRQSTQYTVVKEETESSPPSGVFEKEYDIYRDYNAEGQLLHYRQGASCLL
CSQASKLQPYFRQGTKPPGDLGIWGNGARVCRGRWGSSRRPSGGQQSPNLQTFTPEADNS
VFFPEXKPSPFLKRAEHVGSCSPLLGRGDSFCSPLQTQHRKHSSESQPSSPRYAYEPPLY
EEPPMEYQAPIYDEPPVDMQYEASGSYKAGSPQKSPIRKPHPFLQSPKQGSNSPYQQLVL
TKQKCPXMSLEYSPAGKEYVRQLVYVEQSGSSPKMKTGLRHKYSPNPIGGSYSLQHSPCL
LRDQRLDVKSGDYSSMEGPEWQPAGQAAPGEDSMSWSSQQDTMSSTGYSPPGSALVPVAG
GPKPAPGPHQLGAVLNPSHPHPSARGVQGKKTLTMPFRVPPAPGVHENVSGSQSHLSPAW
CWCPPASSWAWGHQKTVCEGGFVDRGLATPCPAVLSQSEDLGACAQFESSRQTRNMMPSA
SCVFPTFNLRKPSSETDIENWASKHFNKHTQGLFRRKVSIANMLAWSSESIKKPMIMTND
RNVKKEACEIFKLIQMYMGDRRAKTDQLNVALEIATKGWSMQGLRDELYIQLCRQXHITE
NFRYESLARGWELMAICLAFFPPTPKFHSYLEGYIYRHMDPVNDTKVTQHIKEVLERNSK
KKSKLRKKPKPYIEEHDGVAISTYAKYCYNKLQKAALTGAKKGLKKPNIEEIRHAKNAVF
NPSMFGSSLQDIIAMQKERYPDRQLPWVQTRLSEEVLALNGDQTEGIFSSNPPRVPGDID
EVNALKLQVDQWKIPTGLEDPHVPASLLKLWYRELEEPLIPHEFYEQCITHYENPEAAIA
VVHSLPRINKMVLCYLIRFLQVFVQPANVAVTKMDVNNLAMVMAPNCLRCCQSDDPRIIF
ENTRKEMSFIRVLIQHLDTSFMEGVL
Download sequence
Identical sequences U3IDJ8
ENSAPLP00000005320

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]