SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000005395 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000005395
Domain Number 1 Region: 31-82
Classification Level Classification E-value
Superfamily Zn-binding ribosomal proteins 2.93e-19
Family Ribosomal protein L40e 0.011
Further Details:      
 
Domain Number 2 Region: 2-31
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000000000235
Family Ubiquitin-related 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000005395   Gene: ENSAPLG00000005829   Transcript: ENSAPLT00000006025
Sequence length 83
Comment pep:novel scaffold:BGI_duck_1.0:KB744672.1:1:495:1 gene:ENSAPLG00000005829 transcript:ENSAPLT00000006025 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AGKQLEDGRTLADYNIQKESTLHLVLRLRGGIIEPSLRQLAQKYNCDKMICRKCYARLHP
RAVNCRKKKCGHTNNLRPKKKVK
Download sequence
Identical sequences R0KN34
ENSAPLP00000005395

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]