SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000005413 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000005413
Domain Number 1 Region: 92-191
Classification Level Classification E-value
Superfamily E2F-DP heterodimerization region 1.26e-35
Family E2F dimerization segment 0.0000668
Further Details:      
 
Domain Number 2 Region: 15-79
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 4.17e-18
Family Cell cycle transcription factor e2f-dp 0.0003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000005413   Gene: ENSAPLG00000005846   Transcript: ENSAPLT00000006043
Sequence length 303
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB742735.1:747130:755162:-1 gene:ENSAPLG00000005846 transcript:ENSAPLT00000006043 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RLSLQAPKSPSEKTRYDTSLGLLTKKFIQLLSQSPDGVLDLNRAAEVLKVQKRRIYDITN
VLEGIHLIKKKSKNNIQWMGCSLSEDGGMMAQRQGLTKEVTELTQEEKKLDELIQSCTLD
LKLLTEDSENQRYPYVTYQDIRKISGLKDQTVIVVKAPPETRLEVPDPVESALIHLSSTQ
GPIEVYLCPEENDALSPMKTYSQDHNGNISKTISKEVASANSGQGDCSVNMATISPLASP
ANLLQQTEDQIPSNFEGPFVNLLPPLLQEDYLLSLGDEEGISDLFDAYDLEKLPSLVDEF
IYS
Download sequence
Identical sequences U3IDU1
ENSAPLP00000005413

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]