SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000005420 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000005420
Domain Number 1 Region: 6-91
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 6.53e-17
Family Linker histone H1/H5 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000005420   Gene: ENSAPLG00000005857   Transcript: ENSAPLT00000006050
Sequence length 95
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB742579.1:1034355:1189055:1 gene:ENSAPLG00000005857 transcript:ENSAPLT00000006050 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SQIARGRRHPPTLNMVIEALRAQDGTKGASVVTIKRFILAKYPAVDPVRLKYLLKQALAK
GLSRGDLVRPHNSSALGATGRFKVIPRVYKKKLQP
Download sequence
Identical sequences U3IDU8
ENSAPLP00000005420

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]